SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|3hfwA00/1-357 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3hfwA00/1-357
Domain Number 1 Region: 2-345
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.71e-87
Family ADP-ribosylglycohydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|3hfwA00/1-357
Sequence length 357
Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Download sequence
Identical sequences P54922
3hfw_A NP_001116.1.87134 NP_001116.1.92137 NP_001278878.1.87134 NP_001278878.1.92137 XP_011510740.1.92137 ENSP00000349496 ENSP00000417430 ENSP00000417528 ENSP00000420200 GO.34782 GO.57125 HR19 ENSP00000349496 ENSP00000417430 ENSP00000417528 ENSP00000420200 gi|4557263|ref|NP_001116.1| ENSP00000349496 9606.ENSP00000349496 000139339|e3hfwA1|528.1.1.1|A:1-357 cath|current|3hfwA00/1-357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]