SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|4ia8B00/3-79 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4ia8B00/3-79
Domain Number 1 Region: 9-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000181
Family SinR domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|4ia8B00/3-79
Sequence length 82
Sequence
gshmesfllskvsfvikkirlekgmtqedlayksnldrtaisgiernsrnltikslelim
kglevsdvvffemlikeilkhd
Download sequence
Identical sequences 4ia8_A 4ia8_B cath|current|4ia8A00/3-79 cath|current|4ia8B00/3-79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]