SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|4ob4A00/3-71 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4ob4A00/3-71
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000191
Family SinR domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|4ob4A00/3-71
Sequence length 71
Sequence
msseyakqlgaklrairtqqglslhgveeksqgrwkavvvgsyergdravtvqrlaelad
fygvpvqellp
Download sequence
Identical sequences 000160875|e2ewtA1|101.1.4.9|A:1-71 cath|current|2ewtA00/1-71 cath|current|4ob4A00/3-71 cath|current|4ob4B00/3-71 cath|current|4ob4C00/4-71 2ewt_A 4ob4_A 4ob4_B 4ob4_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]