SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d1bykb_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1bykb_
Domain Number 1 Region: 3-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.17e-60
Family L-arabinose binding protein-like 0.00000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1bykb_
Sequence length 255
Comment c.93.1.1 (B:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]}
Sequence
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls
Download sequence
Identical sequences d1byka_ d1bykb_ d4xxha_ d4xxhb_ 4xxh_A 4xxh_B 1bykA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]