SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d1lmb4_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1lmb4_
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.47e-20
Family Phage repressors 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1lmb4_
Sequence length 92
Comment a.35.1.2 (4:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
Sequence
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeavs
Download sequence
Identical sequences 1lmb_3 1lmb_4 1lrp_A 1lrp_B 1lrp_C 1lmb3 001186021|e3bdnB6|101.1.4.9|B:1-92 cath|current|1lmb300/6-92 cath|current|1lmb400/1-92 d1lmb4_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]