SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d4kyob_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4kyob_
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily TPR-like 1.73e-118
Family Tetratricopeptide repeat (TPR) 0.0000000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d4kyob_
Sequence length 315
Comment a.118.8.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
Sequence
qfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneq
ellaisalrrclelkpdnqtalmalavsftneslqrqacetlrdwlrytpayahlvtpae
egaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgey
dkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgi
scinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaad
ardlstlltmfglpq
Download sequence
Identical sequences d3imzb_ d3r9ab_ d4kxkb_ d4kxkd_ d4kyob_ d4kyod_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]