SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436834420|ref|YP_007319636.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436834420|ref|YP_007319636.1|
Domain Number 1 Region: 378-596
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.98e-29
Family ABC transporter ATPase domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 123-178
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000157
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|436834420|ref|YP_007319636.1|
Sequence length 598
Comment DNA mismatch repair protein mutS [Fibrella aestuarina BUZ 2]
Sequence
MLPFTQRQHQFESIAAEAQKQHNTLAIGRLIWFFGTLGTCWLLWANGQSSAGIIVAIVGM
IVFVRLMVWHRAVRRRRDLHLNLAAINADELGRLNRQYTRPETGLNFAPPNHAYAQDLDL
FGNHSLYRLLNRTHTHEGAARLAYYLLQPARPEHIFLRQQAVEALKPHIDWRQELEATAK
LNERIGQSPEGLREWAVGQTPLPGWVNVARFVLPLITLGVVALWLLGNVPGWVVLASLAL
HGTVLSPLQATSKQVSVQTADMANALTDFADLFRFVENMSGDALLLHDLKQRLRVEHGYA
STAIAQLARLVENFNFRQNAYFYLFVGLPTLWDVHYLVALNRWRAQHGPQLATWLATLAE
AESLNSLAGFAYAHPTYAQPDLVDETNPVLEATDMAHPLIVPLRAVTNSLAVSGSGQTVL
ITGSNMSGKSTFLRTLALNVVLAQAGAVASAKRFVCAPVQVYTSMRTQDSLEENTSSFYA
ELKRLRTLLELTDPKNANVSPLPVLYFLDEILKGTNSTDRHKGAEALIRQLHRTSALGFV
STHDLELGQMGDAVDYVQNYHFRSDIHDGQVTFDYTLRPGICQSFNASQLMAAIGIEL
Download sequence
Identical sequences I0K4J0
WP_015330143.1.89626 gi|436834420|ref|YP_007319636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]