SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436834827|ref|YP_007320043.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436834827|ref|YP_007320043.1|
Domain Number 1 Region: 295-532
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.94e-35
Family ABC transporter ATPase domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 38-289
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-17
Family DNA repair protein MutS, domain III 0.009
Further Details:      
 
Domain Number 3 Region: 738-813
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000379
Family Smr domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436834827|ref|YP_007320043.1|
Sequence length 814
Comment Smr protein/MutS2 [Fibrella aestuarina BUZ 2]
Sequence
MLYPNTLEQKLGFDKIRELLRQACISPLGQDYVDKIRFTDNHQLIDKLLRQTYEFTQIVQ
YEPDFPQSNYLDVRPQLQKARVEGITLMEDEFFDLKLALKTIQDCLRFLEKQEEGQYPYL
VELAGPVTVDKGIVAALDRVIDDRGRVRDNASPALADIRRRIISEQANLRKRLDSILRTA
RQQGWIPDDLSLTVRGGRLVIPIAAEHKRKIRGFVHDESDTGKTVYIEPAEVFDGNNEVR
ELEYEERREVFRILLALTDQVRPALPELNKAVNFLAQIDFIRAKAKLAGQLQAGMPQVMN
RPVVNWIAARHPLLYLSHQKQGKAVVPLNIQLDEQPGTPAAGTPAERILIISGPNAGGKS
IALKTIGLLQYMMQCGLLVPMAEHSDMGVFQNLFIDIGDEQSIENDLSTYSSHLTNMQRF
LVGANRRTLFLIDEFGTGTEPGQGGAIAEAILEELNKSGAYGVINTHYTNLKVFADKTPG
LINGAMRFDGEKLEPLYELEMGRPGSSFAFEIAQKINLPNAVINRAKEKLGSQQVNFEKL
LKELDIEKRVFSEKNLDISINQRKLAQQVAEYTALKTKLDNEQKQLINTAKAKAKALVQE
ANQKIENTIREIKETKADKEQTRQVRAELQRFEQASLKPEVIVEPEKPKSAEEEFELAGG
EIGVGNFVRIQGQNAIGEVLAIRGKDAEIRIGELKSNIKLNRLEKVSRKTYREAVGEKQA
PRSQGMDLNEKMMNFSFNLDIRGRRGEEALVEVDKFMDSALMLGYPELRIVHGKGDGILR
QLIRNHLRSYKQVASMADEHADRGGPGVTLVRMK
Download sequence
Identical sequences I0K5P7
WP_015330549.1.89626 gi|436834827|ref|YP_007320043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]