SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436835161|ref|YP_007320377.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436835161|ref|YP_007320377.1|
Domain Number 1 Region: 282-588
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.83e-81
Family DNA repair protein MutS, domain III 0.00000125
Further Details:      
 
Domain Number 2 Region: 591-825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-59
Family ABC transporter ATPase domain-like 0.00000103
Further Details:      
 
Domain Number 3 Region: 121-281
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.53e-39
Family DNA repair protein MutS, domain II 0.00038
Further Details:      
 
Domain Number 4 Region: 9-121
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.27e-38
Family DNA repair protein MutS, domain I 0.000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|436835161|ref|YP_007320377.1|
Sequence length 892
Comment DNA mismatch repair protein MutS [Fibrella aestuarina BUZ 2]
Sequence
MKTAASAKPVKPAKETPLNKQYNIIKAKYPGALLLFRVGDFYETFGEDAVKASKILGITL
TKRNNGGSNEELAGFPHHSLDTHLPKLVRAGERVAICDQLEDPAMAKGIVKRGVTELVTP
GVSFNDNVLDTRRNNYLAAVHFGKGSAGQADDAFGVAFLDISTGEFLASQGNAAYIDKLL
QSFNPAEVLYCKRNRSEFGALFGDKFHTYTLEDWAFTYDFAYNYLKQHFQTTSLKGFGIE
GLPDGIVAAGVILHYLNETEHKDLQHIQRVTRLEEDRYVWLDRFTIRNLELVSSQQEGGV
PLIQILDQTVTPMGARLLRKWLMLPLKDRALIDERLNLVSLLHDDPDLLEAMLTHLKQIG
DLERLVSKVAVRRISPREMVQLKRSLQHVLPIKEMLITALNQPADAPSREAVSLKKYADQ
LNPLSFLLDRIEAELRDDAPVLSTQGNMIQTGVNPDLDELHKLAYSGKEYLAKLQDREIE
RTGISSLKISYNKVFGYYLEVTNAHKNRVPDDWIRKQTLVNAERYITPELKEYEDKILTA
EEQIFSIESRMFGELVTATSEYVATIQQNARVISVLDVLSSFAKVAVKNRYVRPLLNDGK
ALSIKDGRHAVIEQQLPPGEPYVPNDVYLDDETQQIIVITGPNMAGKSALLRQVALIVLM
AQAGSFVPAASAELGIVDKIFTRVGASDNLSRGESTFMVEMTETASILNNLSERSLVLMD
EIGRGTSTYDGVSIAWAITEYLHSTDCRPKTLFATHYHELNELAADLPRIRNFNVAVKEV
GNKVIFLRKLREGGSEHSFGIHVAQMAGMPGSVVKRAAVILKQLEASHQREDNKEAIREA
SQPTERELALRIIEAGDPKSEAIKDKLRTIDVNRLTPIEALLKLNELLNLLA
Download sequence
Identical sequences I0K6N1
gi|436835161|ref|YP_007320377.1| WP_015330883.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]