SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436836082|ref|YP_007321298.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436836082|ref|YP_007321298.1|
Domain Number 1 Region: 5-127
Classification Level Classification E-value
Superfamily ApaG-like 5.23e-42
Family ApaG-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436836082|ref|YP_007321298.1|
Sequence length 128
Comment ApaG domain protein [Fibrella aestuarina BUZ 2]
Sequence
MVSAVTEGIEVIVKTEYQHGYSSPLQAHFVFTYRIAIENHSEHTIQLLRRHWLIYDATGE
VREVEGEGVIGLQPVLEPGERHEYVSGCNLHASMGKMVGSYLVERIIDGKQFRIQVPEFT
MVVPFQLN
Download sequence
Identical sequences I0K9A2
gi|436836082|ref|YP_007321298.1| WP_015331804.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]