SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436837698|ref|YP_007322914.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436837698|ref|YP_007322914.1|
Domain Number 1 Region: 430-476
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000000471
Family Rubredoxin 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|436837698|ref|YP_007322914.1|
Domain Number - Region: 219-287
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00449
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 
Domain Number - Region: 2-63
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00556
Family Duplicated SiR/NiR-like domains 1 and 3 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436837698|ref|YP_007322914.1|
Sequence length 483
Comment Rubredoxin-type Fe(Cys)4 protein [Fibrella aestuarina BUZ 2]
Sequence
MRDYYTLKVNLPAGIVSPRTLQTILRLAYDAQVRTVQFGARQQLLLTVHYEVLRFLEKDL
QQHDITYEVNSEEYPNLISSYCGEAVFQAGGWLSESEYHTVLDQFEYRPRLKVNLADARQ
SFTPFFTGNLNFISSPDPHFWYLYVRPKQSNTLFCWPELVYTNDVGRLAQAVEAAMLTDE
HTDEATLYRTVTARQSFISQPVTQELVLPEFSLPYYEGFNRYGQRSWLGLYRRDEQFSIA
FLLDICALCLKTRIGELCTTPWKSLIIKGIEEKDRADWSYVLGKHNINVRHAANGLAWQT
EDYTDEGTRLKNYVLHYFEKHDTRTFGLCFGIQTRPKSEVFGSVLIRRRPLLRIGQLALF
SVYDVYYTEQFNPNSRVYHRFESGLLKLHLPNQINRLCRQFNTNRLPADRDAQYAEPDLP
EPVADAVEPVHQCPHCLTVYDAAYGDGLNDIPPGTAFADLPDTYACPTCDAPKSAMQAVV
LVA
Download sequence
Identical sequences I0KDW8
WP_015333420.1.89626 gi|436837698|ref|YP_007322914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]