SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436837703|ref|YP_007322919.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436837703|ref|YP_007322919.1|
Domain Number 1 Region: 636-810
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 4-195
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 
Domain Number 3 Region: 506-644
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 153-312
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.18e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|436837703|ref|YP_007322919.1|
Sequence length 839
Comment nitrite reductase (NAD(P)H), large subunit [Fibrella aestuarina BUZ 2]
Sequence
MQHSTSKRIVVVGNGMVGYKFCEKFIAKEKNGQAFSLTVFGEEPRPAYDRVHLSAYLGEK
TADELTMAPVGWYAEQGITLHLSDPVVAIDRDRQQVRSHHGLVVPYDYLVLATGSGAFVP
PVAGVDKDGVFVYRTIEDLDLIQAYARKARRGAVLGGGLLGLEAAKALLDLGLDEAHVVE
FAPRLMPRQIDEAGSEILQRQLEGLGLQIHLAKSTQAITGNETITGMQFTDGTHLDVDML
VISAGIRPRDELARTAGLATHPRGGILVDTYLRTSDPAIFAIGECALVHEMIYGLVAPGY
EMAEVVATQLLGESRAFQPFDMSTKLKLIGTDVGSFGDPFAGEPLHRTIVYTNRAKGVYK
RINVSADGKHLLGGILVGDAEQYNMLLQTCKNQTILPPDPEDLILGTRGGEEAGAGIMSL
PDEALICSCEALTKARLCHEIGENGHTTVEALKKATKACTGCGGCTPMVKDLIQGVLSQQ
GVYVRNVLCEHFDYTRQELFDLVKINGLKIYTDVLNTHGRGDGCEVCKPAVASILASLWN
ENILQKDRAPIQDSNDRFLANIQRGGTYSVVPRIAGGEITPQKLIVIGQVAQKYGLYTKI
TGGQRIDLFGAHVGDLPNIWEELVAAGFESGHAYGKSLRTVKSCVGTTWCRFGVQDSVTF
AVELENRYKGLRSPHKLKSGVSGCTRECAEAQSKDFGIIATEKGWNVYVCGNGGAKPQHA
QLLAADVDKETCIRLLDRFLMFYVKTADPLTRTATWLNKLDGGMTYLRAVVVDDVLGIAA
ELEREMQLLVDTYACEWKAVVDSPELRRRFAHFVNVPEQKDPTVQFEPMRDQIRAKEWA
Download sequence
Identical sequences I0KDX3
gi|436837703|ref|YP_007322919.1| WP_015333425.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]