SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436838740|ref|YP_007323956.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436838740|ref|YP_007323956.1|
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.02e-48
Family Molybdopterin synthase subunit MoaE 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|436838740|ref|YP_007323956.1|
Sequence length 136
Comment Molybdopterin-converting factor subunit 2 Molybdopterin synthase subunit 2 [Fibrella aestuarina BUZ 2]
Sequence
MIALTADPIDFSSAYHYLQTDEAGAIDFFFGVVRNNTQKRDVQQLDYEAYGPMAVREMQK
IADEACRRWNVLRYVIIHRTGVLRIGEMAVLIGVATPHRDAAFEATRYIIDTIKQTVPIW
KKERFTDGEVWVNATP
Download sequence
Identical sequences I0KGW0
WP_015334460.1.89626 gi|436838740|ref|YP_007323956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]