SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|436837263|ref|YP_007322479.1| from Fibrella aestuarina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436837263|ref|YP_007322479.1|
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.4e-57
Family PP-loop ATPase 0.0000567
Further Details:      
 
Domain Number 2 Region: 366-443
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000262
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|436837263|ref|YP_007322479.1|
Sequence length 453
Comment tRNA(Ile)-lysidine synthase [Fibrella aestuarina BUZ 2]
Sequence
MEGFLAFINEHRLFNKTDRLLVAVSGGIDSMVLTDLLHQHGFTFGIAHVNFALRGAESEA
DAVFVENRANDYGVPFHQIRFDTEAEAARRGESVQVTARQLRYGWFAQLCPAHGYVAVAT
AHQADDVLETMLLNLTRGTGLTGLTGIPIRTEQGVVRPLWFASREQIEAYAQERGLPWRE
DTSNATDKYARNRIRHQVVPVLKTINPGLLAHLPRTVGYLRAADAIVQETMTASWAAVAQ
PQPTGVKMDVAAVKALSEPLFRLGEWLRPYGFSAQALQQFWHSVDAEGDTFVKNGQVIQS
ATHRLVHERGAIWLLPQADPLPQPIRVTAWPAQPIDLPGAGYVTAERFDRTNWDGNLKTP
STVALFDAAQLLLPWLLRRWQPGDRFRPLGLAGTQLVSDLLTNAKVPAPQRSSVWVLEAG
GEVMWVIGVRTAHRSRITETTEQIVRLSLTPTT
Download sequence
Identical sequences I0KCN3
WP_015332985.1.89626 gi|436837263|ref|YP_007322479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]