SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21218699|ref|NP_624478.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21218699|ref|NP_624478.1|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.03e-23
Family DNA-binding N-terminal domain of transcription activators 0.0023
Further Details:      
 
Domain Number 2 Region: 122-260
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000366
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21218699|ref|NP_624478.1|
Sequence length 275
Comment MerR family transcriptional regulator [Streptomyces coelicolor A3(2)]
Sequence
MADRLTIGEFSRITHLSIRMLRRYHEQDLLVPAEVDPDTGYRYYSPAQIRPALTVRRFRD
LDLPLADLRRFLAAESADGPDDGTAQQVVAAHLRRLEDRLGRTQRAVEVLRELLDPEAER
AVTLEELPARRVLAVTLDVPEGAGLDWYDEAMCDVDSAAGERSVLPPGGRYEHTLFTEGH
GRATVYVPFEAPLPPEMPGRVRELHLPRRTAAVATHQGRHDDLDLTYGAVGSFAARNDLR
SQDLVEEVYLVGPRDTDRPELWRTLVAWLIAPENG
Download sequence
Identical sequences Q9RIX3
NP_624478.1.49638 WP_011026878.1.30910 100226.SCO0140 NYSGXRC-11183d gi|21218699|ref|NP_624478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]