SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21219242|ref|NP_625021.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21219242|ref|NP_625021.1|
Domain Number - Region: 62-147,258-272
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0445
Family Tricorn protease N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21219242|ref|NP_625021.1|
Sequence length 400
Comment glycosyl hydrolase [Streptomyces coelicolor A3(2)]
Sequence
MTPRHQRPLARRKLLVALGGAVVAAPVAAAVAPHALAGIGPDGPAPAAAGALPLTIVNDT
GSFGNADVHVYIVGNVDGRQVRVTPDGTVAPVALSDNGADGYTDYAIGLSGSGETKLSLP
HLSGRIYVSLGEKLKFKVVADGAGNAALQYPAGWVESDPNYAVLHDCAEFTYNAAGMFCN
TTMVDMFSVPLAIRLTGADDRTTGTVRPGGRAAVFEAVRKVEEFAPLVVDDTRVIAPGHG
LDAGLFPKDYLAPYIDEVWSTYTGKDLRITTNAGTFTGRVRGDRLTFDGPAQVSFAKPST
RDVLFCDGNLAAPNDGTTGPVAAVLGAGFNRSTLVSSAEQPTTDPATFYGTALTNHYAKA
VHAATEDGRAYGFAFDDVADFASYIQDTAPTGIRLTLGAF
Download sequence
Identical sequences Q9L2J3
100226.SCO0716 gi|21219242|ref|NP_625021.1| RR254 NP_625021.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]