SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21220288|ref|NP_626067.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21220288|ref|NP_626067.1|
Domain Number 1 Region: 77-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000314
Family NfeD domain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21220288|ref|NP_626067.1|
Sequence length 143
Comment hypothetical protein SCO1797 [Streptomyces coelicolor A3(2)]
Sequence
MNDIDAWVWWLVAAAALGIPLVVTAMPEFGMFAVGAVAAAVASGLGADLVVQVLVFVIVS
VALIAVVRPIAARHRSQQPQLATGVDALKGRQAVVLERVDGAGGRIKLAGEIWSARALDT
GRAFEPGEEVDVVEIDGATAVIM
Download sequence
Identical sequences A0A1H1XL00 D6ELM5 Q9X9Z5
gi|21220288|ref|NP_626067.1| 100226.SCO1797 NP_626067.1.49638 WP_003977025.1.26049 WP_003977025.1.30910 WP_003977025.1.43399 WP_003977025.1.55229 WP_003977025.1.58943 WP_003977025.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]