SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21220479|ref|NP_626258.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21220479|ref|NP_626258.1|
Domain Number 1 Region: 25-277
Classification Level Classification E-value
Superfamily Cgl1923-like 8.63e-71
Family Cgl1923-like 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21220479|ref|NP_626258.1|
Sequence length 312
Comment hypothetical protein SCO1997 [Streptomyces coelicolor A3(2)]
Sequence
MLDPQDLYTWEPKGLAVVDMALAQESAGLVMLYHFDGYIDAGETGDQIVDQVLDSLPHQV
VARFDHDRLVDYRARRPLLTFKRDTWSDYEEPTIEVRLVQDATGAPFLFLSGPEPDVEWE
RFAAAVGQIVERLGVRLSVSFHGIPMGVPHTRPVGITPHGSRTDLVPGHRSPFEEAQVPG
SAEALVEYRLAQAGHDVLGVAAHVPHYVARSAYPDAALTVLEAITAATGLVLPGIAHSLR
TDAHRTQTEIDRQIQEGDEELIALVQGLEHQYDAAAGAETRGNMLAEPVEIPSADEIGRE
FERFLAEREGDG
Download sequence
Identical sequences A0A1H1YAZ7 D6EKC1 Q9S2K6
100226.SCO1997 gi|21220479|ref|NP_626258.1| NP_626258.1.49638 WP_003976821.1.26049 WP_003976821.1.30910 WP_003976821.1.43399 WP_003976821.1.55229 WP_003976821.1.58943 WP_003976821.1.86682 APC7372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]