SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21220625|ref|NP_626404.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21220625|ref|NP_626404.1|
Domain Number 1 Region: 23-300
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.92e-62
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21220625|ref|NP_626404.1|
Sequence length 545
Comment cytochrome B subunit [Streptomyces coelicolor A3(2)]
Sequence
MSTAANEPSRSRGKAPAGERVADWADGRLGIYSLAKANMRKIFPDHWSFMLGEVCLYSFI
IIILTGVYLTLFFHPSMAEVEYHGSYVPLQGQMMSEAYASTLDISFDVRGGLLIRQIHHW
AALIFLAGMFVHMMRVFFTGAFRKPREVNWLFGFLLLVLGMFTGFTGYSLPDDLLSGTGI
RFMEGAILSVPIVGTYISFFLFGGEFPGHDFVSRFYSIHILLLPGIMLGLLVGHLILVFY
HKHTQFAGPGKTNKNVVGMPLLPVYTAKAGGFFFLVFGVISVVSAIATINPIWAIGPYRP
DQVSTGAQPDWYMGFSEGLIRVMPGWEINAWGHTLVLGVFVPLLIFPLVLAAIAVYPFIE
SWVTGDKREHHILDRPRNAPTRTAFGVAWLTVYFVLLIGGGNDLWATHFHLSINAITWFV
RIAFFVGPVVAFIATKRICLGLQRRDKDKVLHGRESGIIKRLPHGEFIEVHEPLSQEQLH
TLTAHEQYQPAEIGPTVDENGVERKVSGTQKLRAKLSESYYGEESQIPKPTVEEYKEITS
GHGHH
Download sequence
Identical sequences Q9X806
100226.SCO2148 gi|21220625|ref|NP_626404.1| NP_626404.1.49638 WP_011028167.1.30910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]