SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21221028|ref|NP_626807.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21221028|ref|NP_626807.1|
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily DAK1/DegV-like 5.75e-77
Family DegV-like 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21221028|ref|NP_626807.1|
Sequence length 281
Comment hypothetical protein SCO2569 [Streptomyces coelicolor A3(2)]
Sequence
MSRHVAIVTDSTAYLPARAMERHGITAVPLTVVLGDRALEEGTEISTRSLAQALQKRRPV
TTSRPNPELFAETYRRIAESGADGIVSLHLSAELSGTHDAAVVAAREAPVPVRVVDTGMI
AMALGFCALAAAETAEAGGTVDEAVTAAEKRAAGTSAYFYVDTLDYLRRGGRIGAAQALF
GSALAVKPLLQLEGGRIEPLEKVRTASKAIARLEEIAADRAGGAPVDIAVHHLAAPDRAS
ALADRLRDRVPGLADLHVSEVGAVIGAHTGPGLLGVVVSSR
Download sequence
Identical sequences D6ED33 Q9RDL7
NP_626807.1.49638 WP_003976234.1.26049 WP_003976234.1.43399 WP_003976234.1.55229 WP_003976234.1.86682 gi|21221028|ref|NP_626807.1| 100226.SCO2569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]