SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21221546|ref|NP_627325.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21221546|ref|NP_627325.1|
Domain Number - Region: 158-212
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.06
Family Endonuclease I 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21221546|ref|NP_627325.1|
Sequence length 258
Comment lipoprotein [Streptomyces coelicolor A3(2)]
Sequence
MTRHSRIRTGWAAGAAALALALVTGCEGLEADGDAPASGGGAQAPAAGHAVSPLDNPDGT
EPGLAPVTGDSPQAAARKLIDGLPTKGRGPKTGYDRDEFGYAWMDTADGVPLARNGCDTR
NDLLKRDGQEVRFKSGSDCVVIAMTLDDPYTGTSIEWRKQKASEVQIDHVVPLSYSWQMG
SSRWPENKREQLANDPLNLLPVEGRANSAKRDSGPASWLPPDKAVRCAYAVRFAQVAAKY
ELAVTEADRAMMAKQCQG
Download sequence
Identical sequences A0A1H2B445 Q9F2P3
NP_627325.1.49638 WP_011028771.1.58943 gi|21221546|ref|NP_627325.1| 100226.SCO3107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]