SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21221605|ref|NP_627384.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21221605|ref|NP_627384.1|
Domain Number 1 Region: 762-841,937-1146
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.11e-62
Family Tail specific protease, catalytic domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 16-268
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.44e-25
Family Tricorn protease N-terminal domain 0.0000371
Further Details:      
 
Domain Number 3 Region: 300-417,498-627
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 2.09e-17
Family Tricorn protease domain 2 0.0055
Further Details:      
 
Domain Number 4 Region: 847-923
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000064
Family HtrA-like serine proteases 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21221605|ref|NP_627384.1|
Sequence length 1171
Comment protease [Streptomyces coelicolor A3(2)]
Sequence
MRGARKSMGRVSYLRLPHLSGDQLCFVAEDDLWLASLDGPGRAWRLTVDRTKAGPPRFSP
DGRHIAYTSWRTLVPEVHLVPVDGGPGRQLTHWGGLDTRVCGWSPPDPDGTTAVLAVASH
GEPFSHLTWAYKVTPDGDPGRKLPWGPVTDIQAADLDGERRTLLLTGTPPHEPAAWKRYR
GGATGRLWLHGERLLPDLGGHLSAPMFVGGRIAFLSDHEGVGNLYSCAQDGTGLRRHTDH
DAFYARNAASDGTRVVYQCAGDLWIVDDLAPGSAPRRLDVRLSGPRAGRRTHQVPAAQHV
GGISVDETGRASAVVVRGSLYWLTHRDGPARTIADTPGVRVRLPEMLGESGRIAYVTDAE
GEDAVEISYLPRATGGRAARRLASGRLGRVLELVSDPAGDRLAVASHDGRLLILDVAEPD
TEVTLALEAVDAGYPPDAGDEDAAGTAARADSAPDAPAEDTDARDIAAGTGTGDIADADA
AAGGTVTPGSPGTPATAGGQVTELIRSVNGPVRDLAFSPDGTWLTWSHPGIGRTLRQIKM
ARIDGPEGTLVVDVTNGRFEDENPVFTRDGRYLAFLSWRGFDPVYDVHTGDLSFPLGCRP
YLVPLSSATPSPFALNPEGRPAAGGLDPLEDEPGEGGAVMVEVEGLESRVTPFPVTASKY
SALEPVAGGGLVWLRWPISGALGETFANPADPSERPTLEHFNLAKAKKSELVDHLDWFRV
SGDGSRLVVLDEGELRAVPASEVGDGDSTTWIDLRRILHEVDPAAEWRQAYDEAGRLIRA
YFWDPGMCGIDWDAVLDQYRPLLERVASPDEFADLLREVLGELGTSHAYVVAARRNEGPA
HYQRWQGLLGANLACRDGRWLVRRILPGDSSDSKARSPLAGTGIRDGAVLTHVDGRPVDP
VLGPSPLLAGAGGTTVELTFAPAEGCQGPSRRVAVVPLVDERPLRYQDWVAKRREVVREL
SGGRCGYLHIPDMGGSGWAQFNRDLRMEVSRPALIVDVRGNAGGHISELVIEKLTRTILG
WDLTRDAQPVSYTSNAPRGPVVAVADEATSSDGDMITAAFKLLRLGPVVGQRTWGGVVGM
TGRHRLGDGSVITVPMNAAWFDAYGWSVENYGVAPDVEALRTPLDWAEGRYPVLDEAVRL
ALELLETNPPATPPGYEAVPDRSRPPLPPRE
Download sequence
Identical sequences Q9RKB9
NP_627384.1.49638 RR333 100226.SCO3168 gi|21221605|ref|NP_627384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]