SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21222024|ref|NP_627803.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21222024|ref|NP_627803.1|
Domain Number - Region: 102-167
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0102
Family NfeD domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21222024|ref|NP_627803.1|
Sequence length 169
Comment hypothetical protein SCO3608 [Streptomyces coelicolor A3(2)]
Sequence
MAWFLGLGITGVVLLALSLVFDGLLEGVFDGVLDGVLEGWLSLPVVAGFVAMTGFGGAIA
LGSGWTGPAGAAGIGAVAGVGAGWLTYRFGRALMRDQTAVTPRTDDLLGTSGKVVTAIPA
DGYGEVLLRLAGQPLKCAARSTVPLARGAEVWVEAVPTGTSVVVRPVDR
Download sequence
Identical sequences A0A1H2BRZ5 D6EPM0 Q9XAJ4
NP_627803.1.49638 WP_003975331.1.26049 WP_003975331.1.43399 WP_003975331.1.55229 WP_003975331.1.58943 WP_003975331.1.86682 gi|21222024|ref|NP_627803.1| 100226.SCO3608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]