SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21222158|ref|NP_627937.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21222158|ref|NP_627937.1|
Domain Number 1 Region: 278-426
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.44e-33
Family Oxidoreductase molybdopterin-binding domain 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|21222158|ref|NP_627937.1|
Domain Number - Region: 50-207
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00306
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.05
Further Details:      
 
Domain Number - Region: 217-282
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0301
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21222158|ref|NP_627937.1|
Sequence length 428
Comment hypothetical protein SCO3746 [Streptomyces coelicolor A3(2)]
Sequence
MGHWPSGSGAPAYGRSMRDLASRLPSSPGFWRSPLRGPWLTSVLGTVLLVGITVLFVTGL
LSYAAYNPDLAPVNDKTPDKGILGFYLFAWPTDPPWLYRLTQGVHVTLGLVLIPVLLAKL
WSVVPRLFTLPPVRSLAHALERISLLLLVGGALFEFVTGVLNIQLDYLFPGSFYPLHFYG
AWVFFAAFVAHAVLKTPIALRNLRAMREERDDLVSPRPAAPTVSRRGALWFVGGGSLLMF
ATNAGRSFDSPLRATAVLSPHGGPEPGGGPNGFQINKTAAHVGIDPAETGEDTWRLVVTG
RSGTVRFSRAELLAMEQHSVALPIACVEGWSTSDQWWRGVRLRDLAARVGHEDDPPDVFV
ESLQRRGAFRSGALRANQVADPRSLLALQVNGEELSEDHGFPARVIVPAAPGVLNTKWVA
RMTFGDMG
Download sequence
Identical sequences Q9L0V8
NP_627937.1.49638 gi|21222158|ref|NP_627937.1| 100226.SCO3746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]