SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21222257|ref|NP_628036.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21222257|ref|NP_628036.1|
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-78
Family Protein kinases, catalytic subunit 0.0000000428
Further Details:      
 
Domain Number 2 Region: 450-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000288
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|21222257|ref|NP_628036.1|
Domain Number - Region: 383-443
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 
Domain Number - Region: 584-634
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 514-577
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.034
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21222257|ref|NP_628036.1|
Sequence length 673
Comment Ser/Thr protein kinase [Streptomyces coelicolor A3(2)]
Sequence
MEEPRRLGGRYELGPVLGRGGMAEVYHAHDTRLGRQVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYIDNVSIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTI
GILQALEYSHRAGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQAPSVFD
PEITPEMDAIVLKALVKDPDYRYQSADEMRVDIEACLDGQPVGATAAMGAMAAGGYGAYP
DDQPTTALRSDGGGGATTMLPPMNPDDGGYGYDERPDRRRQQPRKKNTSTIFLVLAGVLV
LVGAILIGKYAFSGDGGPGNDKVPVPAFIGLSKADAQQQADNIDLVLTFKQQECEDQPKG
NICAQDPKQGTDVDKESTVNLVVSTGAPKVAVPNVIDKNIDEAKKQLEDKGFEVETKQTE
SSQDEGTILSQNPDPGKELEKGSTVTLEVAKAEEKATVPDVVGRTCDEAKAQVESGGDLT
AVCTDQPTNDPNQVGKVISTTPQSSTQVDPGSKVTIVVGKAVEKTKVPEVRGKTLAEARQ
ILQQSGFTNVQVAQGSPGDDNAKVFASNPQPGSEVDDPAATPITLMTVPGDGGNGNGGNG
NGGAIAGLPGFGD
Download sequence
Identical sequences A0A1H2C236 Q9XA16
NP_628036.1.49638 WP_011029269.1.58943 RR556 gi|21222257|ref|NP_628036.1| 100226.SCO3848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]