SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21222277|ref|NP_628056.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21222277|ref|NP_628056.1|
Domain Number 1 Region: 1061-1409
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.36e-79
Family WD40-repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 1339-1640
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-56
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Weak hits

Sequence:  gi|21222277|ref|NP_628056.1|
Domain Number - Region: 1001-1059
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.00022
Family Nitrous oxide reductase, N-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 151-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000338
Family ABC transporter ATPase domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21222277|ref|NP_628056.1|
Sequence length 1676
Comment WD-40 repeat-containing protein [Streptomyces coelicolor A3(2)]
Sequence
MEALSFDSGARTAFAERLALLYREAGNPPLKRVSEAVVRLQRVDERGRPVRVSAQRISDW
RRAKNVPAQFPALAAVLHVLIPQARRARPVPVSAGLYDLVQWQRLWERALADPSGERPGA
AAVEEQTPAEAPAALGGVCPYRGLAAYRRQDADWFFGRERSTRALLAQLDATRDTGGLVM
LVGASGAGKSSLLNAGLVPALRAGSRDAGCGPPRRVLQLVPGADPLGELTRLVPQLAPVV
VAIRETAGRDPGSPGTWNPGDPETEDAVRAAFAAWAASTEAPSGQEGQEEQEEREGRESR
SGRKGFAGQNGPESQDGPGRRHGLDRQSEPDRHRPGPADPADPGRRTNQAAGADRARQDD
QTERADEAGKTGRTDRDGSTSPSGPDISACRNGETGRTARVSQAVGPDPGDRTDPVAPAG
QADGGDRADADDQPGNTGQVDQTEQTGREGQGQENRGGQGGQGGQTDQSGRSGQTGREIR
HAPIAPARRPDGDGRADPYGEAGQDGQTGQDAQVGQDAQDRQDAQDRQAGLSDRARQADL
GAQDGPASPARQLGRTPSDGETRPDGPPGQANPTARAIRTRPPGTAPPDGREDHAGGPDD
PAAARPVVIVDQFEELFTLCADEADRRVFIQLLQAACLPGAHGDPPPVLVTLGVRADFYD
RCLRYPELADALQHRHMVLGPLTTAELREAVTAPARAVGMELEPGLAELIIREVSTDGPR
GGCDSHAFRAVGEHDAGVLPLLSHALLATWQRRKAGRLTLAGYRAAGGIQGAVAATAERA
WSGLDPAARTAARLLLLRLIRLSEDTQATRRRSTRRRLAEEARDPDKTEESLEALVRARL
VTLDADTVEITHEALLHAWPRLRDWIDEDRAGNLLRQRLEEDGLAWEESDRDSALLYRGS
RLAQADGWAKSADDTFLTRSAVEFLAAAVRLRRRTVMISRAAVSALVVLALLAVGSAVLA
WQQRNDAVFEQVVAEADRVQDTDPSLSAQLDLAAHRLRPDDEDVRNRLISIVNAPLATPL
LGHTGAVYLTSFSPDGRILATASYDRTVRLWDVSDPGRPQQLGKPLTGHTSWVSTAVFSP
DGRTLASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSPDGRTLASAHDDHAV
RLWNVADRRAPEALDTLTGSTGAVRSVAFSPDGDTLASGGDDDKVRLWDVSDPRRPEPAG
APLAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLTGHSGPVWAVA
FSPDGAMLAVSSADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGD
SKVRLWSLPTSEMIGRIGAFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGD
IRSLVFSPDGGTLAVLVGGRALQLWDVTDPAGPTAHGPPVALSTRYAGPDTLAFSPDGRT
LATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGYVNTLAFSPDGRTLASGGADDAVRLWD
VTDPAHATRLGAARTGHLGPVNVLAYSPDGHTLASGSDDGTVRLWDVTEPGEGSGGGTTL
AGHTDSVVSLTFSQDGDTLASGANDNTVRLWSVTDPAEAAPIGRAMSPNAKTGNFLSFSP
VSHMLGVSSGTDTVRLWSLGVDDAIDRICSATRGVLTEEKWHEYLPRLDYEPPCHQ
Download sequence
Identical sequences Q9KXX9
100226.SCO3869 gi|21222277|ref|NP_628056.1| NP_628056.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]