SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21222684|ref|NP_628463.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21222684|ref|NP_628463.1|
Domain Number - Region: 78-124
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0523
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21222684|ref|NP_628463.1|
Sequence length 233
Comment hypothetical protein SCO4291 [Streptomyces coelicolor A3(2)]
Sequence
MPIRTRHRRTSRLAGTAALIAASALALAGCGDGDASTTADEAPARATASATGTATPSGSP
TPEASPSTETPTPTPTPTAVTLPDLTGGSIGAAVSAAEKAHVGYTVRLQGSGQRASSWGS
GEKICEQSGGSGAVTFTVPRDGRDCAGRLLHTPEPAPEPSKTRDSGTGGTSGGTGGGGTG
ACELMSPAGNCYADGQFCAKKHRGLSTHGRGGEYLTCEPDSGGRWRWSDGVSG
Download sequence
Identical sequences Q9KXV0
100226.SCO4291 gi|21222684|ref|NP_628463.1| NP_628463.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]