SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21223001|ref|NP_628780.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21223001|ref|NP_628780.1|
Domain Number - Region: 11-154
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00203
Family Bifunctional DNA primase/polymerase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21223001|ref|NP_628780.1|
Sequence length 283
Comment hypothetical protein SCO4618 [Streptomyces coelicolor A3(2)]
Sequence
MTQPTPYPQHTALSLAASGVPVLPLRRGKVPFGNCTACADNACGGRPNMKAPGPCRCAAP
CHGWAAATTDPAAIVSPEWAAAWRQAVCVAYHPAGAGLTILDLDDADAITWARTTLPATR
TVPTTRGEHWIYRGAMASRNGVRPGVDIKSSMSYARWLGPGSGTIAALPDAVRALAVKEP
SPAFSAAQTPPAPLRGGQGECPHRTPAFLERGVTMAVQRITDASSAVHATVYRTFLAVLS
RHGRCGCLTDAHVARLFTTAQAKGETPRHCTDAWNNARTTLGL
Download sequence
Identical sequences Q9F2U4
NP_628780.1.49638 gi|21223001|ref|NP_628780.1| 100226.SCO4618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]