SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21223736|ref|NP_629515.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21223736|ref|NP_629515.1|
Domain Number 1 Region: 241-504,564-604
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.68e-84
Family Type II chitinase 0.00000402
Further Details:      
 
Domain Number 2 Region: 30-132
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.19e-29
Family Cellulose-binding domain family II 0.00024
Further Details:      
 
Domain Number 3 Region: 141-226
Classification Level Classification E-value
Superfamily Fibronectin type III 4.76e-16
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 4 Region: 506-565
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000407
Family Chitinase insertion domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21223736|ref|NP_629515.1|
Sequence length 609
Comment chitinase C [Streptomyces coelicolor A3(2)]
Sequence
MRFRHKAAALAATLALPLAGLVGLASPAQAATSATATFAKTSDWGTGFGGSWTVKNTGTT
SLSSWTVEWDFPTGTKVTSAWDATVTNSGDHWTAKNVGWNGTLAPGASVSFGFNGSGPGS
PSNCKLNGGSCDGTSVPGDAAPSAPGTPTASNITDTSVKLSWSAATDDKGVKNYDVLRDG
AKVATVTGTTYTDNGLTKGTAYSYSVKARDTADQTGPASGAVKVTTTGGGDGGNPGTGAE
VKMGYFTNWGVYGRNYHVKNLVTSGSADKITHINYAFGNVQGGKCTIGDSYADYDKAYTA
DQSVDGVADTWDQPLRGNFNQLRKLKAKYPNIKILYSFGGWTWSGGFPDAVKNPAAFAKS
CHDLVEDPRWADVFDGIDLDWEYPNACGLSCDETSAPNAFSSMMKAMRAEFGQDYLITAA
VTADGSDGGKIDAADYGEASKYIDWYNVMTYDFFGAWAKNGPTAPHSPLTAYDGIPQQGF
NTADAMAKFKSKGVPADKLLIGIGFYGRGWTGVTQSAPGGTATGPATGTYEAGIEDYKVL
KNSCPATGTIAGTAYAHCGSNWWSYDTPATIKSKMDWAEQQGLGGAFFWEFSGDTTNGEL
VSAIDSGLK
Download sequence
Identical sequences A0A1H2CXD8 Q7AKG2 Q9Z9M8
NP_629515.1.49638 WP_011030211.1.30910 WP_011030211.1.58943 100226.SCO5376 gi|21223736|ref|NP_629515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]