SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21223967|ref|NP_629746.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21223967|ref|NP_629746.1|
Domain Number 1 Region: 23-209
Classification Level Classification E-value
Superfamily Prim-pol domain 1.5e-39
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 457-617
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000246
Family Shikimate kinase (AroK) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21223967|ref|NP_629746.1|
Sequence length 756
Comment ATP binding protein [Streptomyces coelicolor A3(2)]
Sequence
MSYTTSEARDLAATQSGLDVPEHDTDRAAYFARLGFGVFPMPTNKKMPRAKGWPDLAMTT
VEEVEEMWRSFTPSGWQNIALTLDGWTVVDVDPKNGGTASLEKLTAEYELPVTRTHHTAS
GPDSLHFIYRADPDRPIKSGPLSSRYPGIDIKTGRGSLIVAPGSVINGRRYEVVSAAEPA
VAPSWLSEIRGDAQYPVVPSARSRTPSRASAGHSRAATLAELRALPPDDPGRGNGWLTQV
AGHLARNHTDHDSYLHELRAIDSESEVPHDKDRFMKTADSIWEREQAKERPKAAAPDKPK
SILWHHEHTDLGNGRRLRDLHGEDMRHAPGWGWLTWDGRRWARGDGQARRFMHSVADAIS
EAIESMEEKQRSDDLMRWFGRSCSGPGISAALNEASVMLPIETEISDFDADPHKLLVGNG
VVDLRTGELLPVDRKYLLTRGTTVEYDPNADCPMWMDFLGWAFQGDIEMIEYIQRMFGMC
LIGNNAHQVAFFLYGPGRSGKTTLTRVLSRLLGDYATSADLSVFNESSSGHNEPLARLAG
ARLVVFSETRQGQRINEAQFKKFTGEDTLTASYKNKSWFEFLPAFTPVMFGNAQPSIAFD
SGVERRMKVIPMRAQISDGQKNPKLVEQMMLNEGPAIMAWAVEGARLTAAESFVPDPPQV
AQAVKEYKRENDHIGDFIEECLVFDEGATVASDVVWGRYSKWIEAGGVDFVKKADDRAGK
SLLVRMLKTWSIENGTPIESFKSSNTRKLRGVALND
Download sequence
Identical sequences O69900
NP_629746.1.49638 100226.SCO5612 gi|21223967|ref|NP_629746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]