SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225003|ref|NP_630782.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225003|ref|NP_630782.1|
Domain Number 1 Region: 130-197
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000017
Family PriA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21225003|ref|NP_630782.1|
Sequence length 341
Comment hypothetical protein SCO6709 [Streptomyces coelicolor A3(2)]
Sequence
MAEAVELEAGGRSVRLSSPGKVFFPEHGYTKLDVARYYQAVAPGVLRALRERPTTLQRYP
DGITGEWFYQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVLWAAQYGTLTFHPWP
VRRDDVDHPDELRIDLDPQPGTDYDDAARAAHELRAVLEEFGGLRGWPKTSGGRGIHVFV
PIEPRWTFTQVRRAAIAVGREMERRMPERVTIKWWKEERGERIFIDYNQTARDRTIASAY
SVRPRPNAPVSAPLTWDEVGVAHPRDFDITTMPARFAELGDVHAGMDDTRYSLDALLELA
TKDEHDHGLGDLPYPPEYPKMPGEPSRVQPSRARKKAPGPD
Download sequence
Identical sequences A0A1H2D9Y2 D6EFA3 Q9XAM1
100226.SCO6709 gi|21225003|ref|NP_630782.1| NP_630782.1.49638 WP_003972287.1.26049 WP_003972287.1.43399 WP_003972287.1.55229 WP_003972287.1.58943 WP_003972287.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]