SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225349|ref|NP_631128.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225349|ref|NP_631128.1|
Domain Number 1 Region: 2-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.2e-114
Family FMN-linked oxidoreductases 0.00000000137
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-44
Family N-terminal domain of adrenodoxin reductase-like 0.00000904
Further Details:      
 
Domain Number 3 Region: 468-626
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21225349|ref|NP_631128.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase [Streptomyces coelicolor A3(2)]
Sequence
MSRYPHLLSPLDLGFTTLPNRVLMGSMHVGLEEAERGFERMAAFYAARARGGVGLIVTGG
IAPNDEGRPYEGGARLTTGAEAEQHRVVTDAVHREGGRIALQILHFGRYAYHADLVAPSA
LQAPISPHVPRELTDAEVERTIDDYVRTARLAREAGYDGVEIMGSEGYLINEFIAARTNH
RSDRWGGSYENRMRFPVEIVRRVREAVGADFIVVYRLSMLDLVPGGSTLDEVITLAKAVE
AAGATIINTGIGWHEARIPTIATSVPRGAYTWVTKRLMGEVSVPLVTTNRINTPEVAEAL
LAEGTADMVSMARPMLADPDFVAKAAAGRAEAINTCIGCNQACLDHTFSGQITSCLVNPR
ACHETELVLAPTRRRKRVAVVGAGPAGLACAVSAAERGHEVTLFDAASEIGGQLNVARKI
PGKQEFDETLRYFRTQLAAHGVDVRLNTRVGVADLTGHDEVVVATGVTPRTPDIPGVDHP
SVVGYLDVLRDAAPVGERVAILGAGGIGFDVAEYLTDGGDKAHEDPETYFRLWGVDTDYR
APGGLAAPERPAPPRTVHLLQRKTSKVGAGLGKTTGWIHRTELRHRGVTMVPGVRYDRID
DAGLHITVGDESTVLEVDTVVLCTGQEPSRGLYDDLVAAGHRAHLIGGADVAAELDAKRA
VKQGTELAAAL
Download sequence
Identical sequences Q9FC18
NP_631128.1.49638 100226.SCO7066 gi|21225349|ref|NP_631128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]