SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225455|ref|NP_631234.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225455|ref|NP_631234.1|
Domain Number 1 Region: 224-514
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-78
Family Subtilases 0.00000323
Further Details:      
 
Domain Number 2 Region: 808-905
Classification Level Classification E-value
Superfamily PA domain 0.0000034
Family PA domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|21225455|ref|NP_631234.1|
Domain Number - Region: 1178-1240
Classification Level Classification E-value
Superfamily E set domains 0.0007
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21225455|ref|NP_631234.1|
Sequence length 1253
Comment peptidase [Streptomyces coelicolor A3(2)]
Sequence
MPIPWSRGRGLTVGIAALLVLTATAPAASALPGTVPPAPPTAPAGPTRVLTLITGDRVTV
TGEDGAETVLSVTDPHGRSGGAHVMTVGSDTYVYPDAAVPYLGSGALDERLFNVTELLED
GYDDARADELPLIVTYTDTAARSLGARTPEGARRTRALSSIRGAAISAEHSRAADFWTSL
TGTGDAAAGGSAARSATSGGRLAGGIAKVWLDGKVRATLSDTTAQIGAPDVWSGGNTGEG
VGVAVLDTGVDAGHPDFAGRIAATASFVPDQDVTDRNGHGTHVASTVAGTGAASGGVEKG
VAPGASLHIGKVLDNSGSGQDSWVLAGMEWAVRDQHAKIVSMSLGDSPTDGTDPLSEAVN
WLSAETGALFVVAAGNSGPEAYTVGTPAAADAALTVGAVNGPGKGVDQLADFSSRGPRVG
DNAVKPDLTAPGVGVLAARSRYAPEGEGAYQSLSGTSMATPHVAGAAALLAAEHPDWTGQ
RLKEALVGTTAGTQRFSPFDAGSGRVDVAAAVRSTLLASGDAFAQAHYPYTPGQTVRRDV
TYTNSGPAPVALDLALSPAELPEGLFTLSEAQVTVPAHGTASVGVITHLDAAEDNGAYAT
RLVASGADGAVLARTPVGVNKEGRRATLALTAKDHHDKPLSGTVILKDVERNTAPKVYSV
DASGRLDLRLSPSTYSVWMNSAVPGVDGTHTLGFAMFTAPEVVLDADRTVAFDADDLRKA
AAVTPRATANQFLRIDQYRGNTGLFPFMDSYVAEYWRYDSLWVTPTPEVRTGSYTFATRW
RQIQPPLTFSAGSQTFDDVTVQSRSPQLPEGTRAYRAVWAGDGSATEFRGAEVRDRVAVV
RRSDTVAPTDQAAAAEKAGARQLLILNDGYGKFDPWADLPEAAPLPVASLGTDDSARLLA
RFRGAGTTTLRVVSHPVPRYAYDLVRHHDGAVPRDPSYRPAPGELARVDDTFRDTSQGRA
VEYRQDISLLGQPLGIVPTQVRAQGELTSWVTADDDVRWVSFASRPDLGQRGVARSYEPR
STTRETWFAPIQHPRLLSDNGTSGQGPFRAGDNISTSVMTAWGDSGGHAGVVWADGDTSR
ISLYQGGELLGEDVNERIVMVGGLSPGPKPYRLVLEGSRNLPDRPYSTRTRTVWDFTSAT
TDPTRLTPLPLVQLDYAVAVDLSGRAHRRTELTVTASHLEGAAGAGAIRTATVEVSYDDG
ATWHRTALRKSADGWTARLDAPGRARYASLRTTAKDTEGNGVGQTLIRAFGLR
Download sequence
Identical sequences Q9FC06
gi|21225455|ref|NP_631234.1| 100226.SCO7176 NP_631234.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]