SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225467|ref|NP_631246.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225467|ref|NP_631246.1|
Domain Number 1 Region: 228-513
Classification Level Classification E-value
Superfamily Subtilisin-like 2.23e-78
Family Subtilases 0.00000501
Further Details:      
 
Domain Number 2 Region: 800-874
Classification Level Classification E-value
Superfamily PA domain 0.00000165
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|21225467|ref|NP_631246.1|
Domain Number - Region: 1167-1227
Classification Level Classification E-value
Superfamily E set domains 0.0217
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21225467|ref|NP_631246.1|
Sequence length 1239
Comment peptidase [Streptomyces coelicolor A3(2)]
Sequence
MKQHPRCWSATAVAAVSVLVFTGPFSVQAVAGPSSAPALAAHEAPSSTGVPTGEHTVTLI
TGDVVTTRQGSGGAGGTVTVRDADGKPARARLTEADGDLFVYPESALPFVAKGSLDRELF
NVTGLIGDGYDDASRERLPLIVSYRNAAAHRTAAVPDGARKVRDLASVQGAALSADRARA
AEFWRSVTGEGPAGGGVRDSGTDAAFRGGVAHIWLDAPVEADLADSTAQIGAPRAWAGGN
TGQGVEVAVLDTGVDAGHPDLADRIAARQSFVPDENTDDRDGHGTHVASTIAGTGAASAG
KEKGVAPGARLSIGKVLDNSGRGQISWTLAAMEWAAVERHAKIVNMSLGSGEQSDGSDPM
SRAVDRLSAQTGALFVVAAGNGGEAGSIGAPGVATSALTVGAVDATDTLAPFSSQGPRVD
GALKPEITAPGVGILAANSSFAAGGNGAYQSLSGTSMATPHVAGAAALLAAARPDLSGSA
LKDVLASSSHRTPRYDAFQAGSGRVDVDAAVRAGVYASATAYAPGSSPGPVRRLVTYTNT
TGAAVTLELSVAATHAPEGVFRLSASRVTVPAHGTADVTLTIDGSGSAGGRAYSGQILAT
DADARNVAHTAVSAGPVRHKLTVHFKDADGNPVPGVFDLLKSGDSESLPVLVGDSGTAEL
YLPEDTYSALAFKTVPGVHGPHSWGMALLGDPEVRLTEDTAVTFDASRVERIETTVPQRT
EATYQRLDYQRSMGGTTYRTGLETQTAYDSLWAQPTTHKVTHGDFLVNARWRKEQPALTV
STRTTDFTDVLRQGGVTALPKGTRTLPLVFAGDGAAAEYARLDARGKAVVVRRDDDVADG
VQAANAVAAGATLLLVVNNEDGRALRGYGEPFGPPVALDVALLSTDEGEKLAAQAKVRGA
RVTVTSRPVSPYVYDLLASWHNEIPTRMTSRADSRSLARVDVAFDSPLPGGSGGEFRYDW
VPGSGWTFGGPQPEPVSGTRTDWVSTGDYRWNQEAYAGGVIYEIGAKTAYRPGSRQSEEW
FGPVERPHLNDAYRSPLRIGDSMAIDVPAWGSRDHIGLSQDDTGTTTQHMTLSQGGTTLG
EGVFSLVEGKAPGPGKLPYRLVVTGEREAPFTPYSSATRTQWDFVSAAAADPEARTVLPL
VQLDYRVDVDGAGRAKRHTTVTVTAAHLPGAAPVGRLGAPALELSYDDGRTWHRAARTGD
GGFRLDAPSRAEFVTVRASARDTLGNTIHQTVTRAFGLR
Download sequence
Identical sequences Q9FBZ4
gi|21225467|ref|NP_631246.1| 100226.SCO7188 NP_631246.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]