SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225503|ref|NP_631282.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225503|ref|NP_631282.1|
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000248
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21225503|ref|NP_631282.1|
Sequence length 146
Comment hypothetical protein SCO7226 [Streptomyces coelicolor A3(2)]
Sequence
MAVMDPWLIWLIVSAVLVLAEIFTLTAALGMLGVAALITAGSAAAGLSTPFQFLVFTVVS
AVTLFFLRPVALRHLVQPQTQRFGVDALVGQAAYVVSDVTGREGRVRIGGEEWTARSYDE
TLVIPRGATVDVLEISGTTAFVYPRE
Download sequence
Identical sequences Q9K459
100226.SCO7226 NP_631282.1.49638 WP_011031525.1.26049 WP_011031525.1.55229 WP_011031525.1.58943 WP_011031525.1.86682 GO.3498 gi|21225503|ref|NP_631282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]