SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21234016|ref|NP_639593.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21234016|ref|NP_639593.1|
Domain Number 1 Region: 177-244
Classification Level Classification E-value
Superfamily Barstar-related 0.00000000000000628
Family Barstar-related 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21234016|ref|NP_639593.1|
Sequence length 272
Comment hypothetical protein SCP1.17 [Streptomyces coelicolor A3(2)]
Sequence
MRTSGRGGEGQKYALTSDEDDSDFWGFAQEVEGLFTPLPDEDGARRVHLAGCLPQGGLLR
CVDHVGTRRAVAGNAWFELLDGDGATMGSYFVNEVTVIDVKPSASGAGLVDLTVTLWCEN
ALPGAERPWELVRTGRLNHTGMWHELAPEDRHAWLSVALWSREYQRQAKPDAPAGQVFTL
DGRHIVDRDTFYCAIGEAINGPGGYFGWNLDALDDCLRGGWGATTPFTLHWDFSAEARTR
LAEHVPAGDRELVLFDLLLEIFEERGVSVILR
Download sequence
Identical sequences Q99QK6 S4WAP1
gi|21234016|ref|NP_639593.1| gi|21234334|ref|NP_639945.1| 100226.SCP1.17 100226.SCP1.337c NP_639593.1.49638 NP_639945.1.49638 gi|21234016|ref|NP_639593.1|NC_003903 gi|21234334|ref|NP_639945.1|NC_003903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]