SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21234340|ref|NP_639951.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21234340|ref|NP_639951.1|
Domain Number 1 Region: 160-231
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 6.24e-19
Family Recombination endonuclease VII, N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21234340|ref|NP_639951.1|
Sequence length 247
Comment hypothetical protein SCP1.343 [Streptomyces coelicolor A3(2)]
Sequence
MIPSGFSLKGGVSPIRQHDRRERHAALEVAMRKPHDPHEQTLPAHLVAIVDAAIRRRAGK
EPCAPDDLGIRDQRYARRPLDGSAGYHLWSPTHGLGFCNRHARRRGFLPYWRDEELGPPM
AAVHVPPEQRCGGWVAPRYLPRPWIGPLPERWPEERIPIWYAWWRLHDIQDGTCATCSAP
AYAIDHDHHTGLVRGLLCVSCNKREGTCRRRAQEGTHPGRPCFQPYWDDPPAAPLRWMHG
KSSLSAA
Download sequence
Identical sequences Q99PZ8 S4W8B6
gi|21234010|ref|NP_639587.1|NC_003903 gi|21234340|ref|NP_639951.1|NC_003903 NP_639587.1.49638 NP_639951.1.49638 100226.SCP1.11c 100226.SCP1.343 gi|21234010|ref|NP_639587.1| gi|21234340|ref|NP_639951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]