SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21225632|ref|NP_631411.1| from Streptomyces coelicolor A3(2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21225632|ref|NP_631411.1|
Domain Number 1 Region: 87-182,212-346
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.39e-28
Family GpdQ-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21225632|ref|NP_631411.1|
Sequence length 500
Comment hypothetical protein SCO7358 [Streptomyces coelicolor A3(2)]
Sequence
MSNSSRDSAEGAGWGSAEPGAYRALMPGRTEKLSWLSPRTLWAARNGVLASWFGDPTGRT
RSRWVAQRAAAGAPADKVIGRDDPDRFSFLVIGDTGEGDDPQYAVVPGLLEAGRDTRFAV
LASDVIYPVGSADDYGTKFFRPYRDYRAPIYAIPGNHDWYEDLGAFMRVFCDDAPPLAPE
AAPRRFTRAWLRSLLWHRPRPEDGARLAEARELRPAPSQQAAQPGPYWAVDAGPVRIVGI
DTGLLGTVDAEQGAWLREVSAGDRPKILVTGSPLYVDGEHHPCEIEGGGTVDDIVRDPAH
HYVAAIGGDIHNYQRYPVDVDGRTVQYVVAGGGGAFMHATHTIPRVSVAGVTEDDFRSYP
LRGDSLAFYSALYGRRLRMRRLFTLTEAEATAVIAERLGIRTGRAPGDGARVTRRTRIVA
GLLGTARRPERRKRFRLPVRKIYTSVFSPGSATYSPPFFKCFLRLDVTPEAVRLRCYAAT
GNRAQEVDPPVEDEVTIPLG
Download sequence
Identical sequences Q9KYM7
gi|21225632|ref|NP_631411.1| NP_631411.1.49638 WP_003971785.1.26049 WP_003971785.1.55229 100226.SCO7358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]