SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759193|ref|NP_454810.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759193|ref|NP_454810.1|
Domain Number 1 Region: 2-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.26e-138
Family GABA-aminotransferase-like 0.00000000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16759193|ref|NP_454810.1|
Sequence length 426
Comment glutamate-1-semialdehyde 2,1-aminomutase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLLEAAEEANIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFEAGFMSVAHSMDDINNTIDAAR
RVFAKL
Download sequence
Identical sequences A0A2D3TZT4 Q8Z9B4
NP_454810.1.84458 WP_000045264.1.100002 WP_000045264.1.100008 WP_000045264.1.100036 WP_000045264.1.100079 WP_000045264.1.100196 WP_000045264.1.100284 WP_000045264.1.100313 WP_000045264.1.100314 WP_000045264.1.100321 WP_000045264.1.100354 WP_000045264.1.100421 WP_000045264.1.100446 WP_000045264.1.100450 WP_000045264.1.100472 WP_000045264.1.100592 WP_000045264.1.100610 WP_000045264.1.100732 WP_000045264.1.100733 WP_000045264.1.100739 WP_000045264.1.100764 WP_000045264.1.100799 WP_000045264.1.100941 WP_000045264.1.100953 WP_000045264.1.101011 WP_000045264.1.10108 WP_000045264.1.101226 WP_000045264.1.10124 WP_000045264.1.101312 WP_000045264.1.101322 WP_000045264.1.101374 WP_000045264.1.101520 WP_000045264.1.101616 WP_000045264.1.101890 WP_000045264.1.101941 WP_000045264.1.102050 WP_000045264.1.102087 WP_000045264.1.10338 WP_000045264.1.1038 WP_000045264.1.104 WP_000045264.1.10401 WP_000045264.1.10428 WP_000045264.1.10459 WP_000045264.1.10475 WP_000045264.1.10511 WP_000045264.1.10514 WP_000045264.1.10530 WP_000045264.1.10532 WP_000045264.1.10547 WP_000045264.1.10595 WP_000045264.1.10642 WP_000045264.1.10654 WP_000045264.1.10677 WP_000045264.1.10857 WP_000045264.1.10873 WP_000045264.1.10926 WP_000045264.1.10936 WP_000045264.1.11012 WP_000045264.1.11055 WP_000045264.1.11126 WP_000045264.1.11142 WP_000045264.1.11239 WP_000045264.1.11253 WP_000045264.1.11314 WP_000045264.1.11385 WP_000045264.1.1142 WP_000045264.1.11426 WP_000045264.1.11429 WP_000045264.1.11557 WP_000045264.1.11567 WP_000045264.1.11638 WP_000045264.1.11883 WP_000045264.1.11908 WP_000045264.1.11914 WP_000045264.1.12040 WP_000045264.1.12061 WP_000045264.1.1207 WP_000045264.1.12141 WP_000045264.1.12172 WP_000045264.1.12192 WP_000045264.1.1224 WP_000045264.1.12364 WP_000045264.1.12398 WP_000045264.1.12441 WP_000045264.1.12581 WP_000045264.1.12620 WP_000045264.1.12648 WP_000045264.1.12683 WP_000045264.1.12726 WP_000045264.1.12727 WP_000045264.1.12741 WP_000045264.1.12834 WP_000045264.1.13108 WP_000045264.1.13161 WP_000045264.1.1321 WP_000045264.1.13268 WP_000045264.1.13291 WP_000045264.1.133 WP_000045264.1.13314 WP_000045264.1.13338 WP_000045264.1.13342 WP_000045264.1.13352 WP_000045264.1.13406 WP_000045264.1.13440 WP_000045264.1.13443 WP_000045264.1.13476 WP_000045264.1.13599 WP_000045264.1.13686 WP_000045264.1.1372 WP_000045264.1.13732 WP_000045264.1.1382 WP_000045264.1.13972 WP_000045264.1.140 WP_000045264.1.1401 WP_000045264.1.1408 WP_000045264.1.14089 WP_000045264.1.14099 WP_000045264.1.14120 WP_000045264.1.14123 WP_000045264.1.14150 WP_000045264.1.14197 WP_000045264.1.14280 WP_000045264.1.14333 WP_000045264.1.14399 WP_000045264.1.14444 WP_000045264.1.14467 WP_000045264.1.14474 WP_000045264.1.14500 WP_000045264.1.14526 WP_000045264.1.14550 WP_000045264.1.14575 WP_000045264.1.14701 WP_000045264.1.14703 WP_000045264.1.14719 WP_000045264.1.1473 WP_000045264.1.14765 WP_000045264.1.14810 WP_000045264.1.14877 WP_000045264.1.14930 WP_000045264.1.14947 WP_000045264.1.14948 WP_000045264.1.15079 WP_000045264.1.15184 WP_000045264.1.15244 WP_000045264.1.15265 WP_000045264.1.15362 WP_000045264.1.15415 WP_000045264.1.15423 WP_000045264.1.15433 WP_000045264.1.15439 WP_000045264.1.15487 WP_000045264.1.15535 WP_000045264.1.15581 WP_000045264.1.15597 WP_000045264.1.15710 WP_000045264.1.15717 WP_000045264.1.15905 WP_000045264.1.15909 WP_000045264.1.15912 WP_000045264.1.15970 WP_000045264.1.16006 WP_000045264.1.16046 WP_000045264.1.16051 WP_000045264.1.16058 WP_000045264.1.16150 WP_000045264.1.16155 WP_000045264.1.1626 WP_000045264.1.16264 WP_000045264.1.16344 WP_000045264.1.16452 WP_000045264.1.16461 WP_000045264.1.16462 WP_000045264.1.16465 WP_000045264.1.16522 WP_000045264.1.16588 WP_000045264.1.16658 WP_000045264.1.16666 WP_000045264.1.16673 WP_000045264.1.1674 WP_000045264.1.16767 WP_000045264.1.16781 WP_000045264.1.16879 WP_000045264.1.16893 WP_000045264.1.16905 WP_000045264.1.16948 WP_000045264.1.17049 WP_000045264.1.17058 WP_000045264.1.17078 WP_000045264.1.17202 WP_000045264.1.17219 WP_000045264.1.1722 WP_000045264.1.17302 WP_000045264.1.17308 WP_000045264.1.17368 WP_000045264.1.17405 WP_000045264.1.17406 WP_000045264.1.17513 WP_000045264.1.17543 WP_000045264.1.17563 WP_000045264.1.17578 WP_000045264.1.17622 WP_000045264.1.17659 WP_000045264.1.17667 WP_000045264.1.17686 WP_000045264.1.17741 WP_000045264.1.17840 WP_000045264.1.17956 WP_000045264.1.18005 WP_000045264.1.1801 WP_000045264.1.18021 WP_000045264.1.18099 WP_000045264.1.18124 WP_000045264.1.18144 WP_000045264.1.18173 WP_000045264.1.18270 WP_000045264.1.18280 WP_000045264.1.18328 WP_000045264.1.18358 WP_000045264.1.18370 WP_000045264.1.18406 WP_000045264.1.18474 WP_000045264.1.18513 WP_000045264.1.18610 WP_000045264.1.18678 WP_000045264.1.18722 WP_000045264.1.18766 WP_000045264.1.1880 WP_000045264.1.1885 WP_000045264.1.18860 WP_000045264.1.18922 WP_000045264.1.18959 WP_000045264.1.18972 WP_000045264.1.19001 WP_000045264.1.19006 WP_000045264.1.19044 WP_000045264.1.19084 WP_000045264.1.19187 WP_000045264.1.19228 WP_000045264.1.19288 WP_000045264.1.19300 WP_000045264.1.19422 WP_000045264.1.19454 WP_000045264.1.19456 WP_000045264.1.19496 WP_000045264.1.19535 WP_000045264.1.19538 WP_000045264.1.19589 WP_000045264.1.19660 WP_000045264.1.19663 WP_000045264.1.19686 WP_000045264.1.19731 WP_000045264.1.19794 WP_000045264.1.1992 WP_000045264.1.19999 WP_000045264.1.20254 WP_000045264.1.20255 WP_000045264.1.20296 WP_000045264.1.20339 WP_000045264.1.20376 WP_000045264.1.20419 WP_000045264.1.20465 WP_000045264.1.20492 WP_000045264.1.2053 WP_000045264.1.20635 WP_000045264.1.20718 WP_000045264.1.2073 WP_000045264.1.20740 WP_000045264.1.20828 WP_000045264.1.2087 WP_000045264.1.20883 WP_000045264.1.20947 WP_000045264.1.20953 WP_000045264.1.21010 WP_000045264.1.2106 WP_000045264.1.21062 WP_000045264.1.21144 WP_000045264.1.21162 WP_000045264.1.21184 WP_000045264.1.21185 WP_000045264.1.21366 WP_000045264.1.21492 WP_000045264.1.2166 WP_000045264.1.21674 WP_000045264.1.21946 WP_000045264.1.21966 WP_000045264.1.22064 WP_000045264.1.22118 WP_000045264.1.22126 WP_000045264.1.2216 WP_000045264.1.22208 WP_000045264.1.2227 WP_000045264.1.22373 WP_000045264.1.22476 WP_000045264.1.22614 WP_000045264.1.22652 WP_000045264.1.22683 WP_000045264.1.2284 WP_000045264.1.22895 WP_000045264.1.22926 WP_000045264.1.22943 WP_000045264.1.22967 WP_000045264.1.23040 WP_000045264.1.23058 WP_000045264.1.23169 WP_000045264.1.23218 WP_000045264.1.2331 WP_000045264.1.2332 WP_000045264.1.23340 WP_000045264.1.2336 WP_000045264.1.23365 WP_000045264.1.23412 WP_000045264.1.23426 WP_000045264.1.23492 WP_000045264.1.23548 WP_000045264.1.23571 WP_000045264.1.23604 WP_000045264.1.23679 WP_000045264.1.23728 WP_000045264.1.2375 WP_000045264.1.23783 WP_000045264.1.23786 WP_000045264.1.23787 WP_000045264.1.23801 WP_000045264.1.24028 WP_000045264.1.24061 WP_000045264.1.24083 WP_000045264.1.24117 WP_000045264.1.24125 WP_000045264.1.24138 WP_000045264.1.24153 WP_000045264.1.24163 WP_000045264.1.24291 WP_000045264.1.24322 WP_000045264.1.24355 WP_000045264.1.24375 WP_000045264.1.24400 WP_000045264.1.24420 WP_000045264.1.24433 WP_000045264.1.24619 WP_000045264.1.24643 WP_000045264.1.24688 WP_000045264.1.24716 WP_000045264.1.2481 WP_000045264.1.24832 WP_000045264.1.24964 WP_000045264.1.25017 WP_000045264.1.25032 WP_000045264.1.25041 WP_000045264.1.25053 WP_000045264.1.25140 WP_000045264.1.25185 WP_000045264.1.25196 WP_000045264.1.25210 WP_000045264.1.25219 WP_000045264.1.25304 WP_000045264.1.25374 WP_000045264.1.25475 WP_000045264.1.25490 WP_000045264.1.25508 WP_000045264.1.25512 WP_000045264.1.25603 WP_000045264.1.2562 WP_000045264.1.25666 WP_000045264.1.25722 WP_000045264.1.25807 WP_000045264.1.25821 WP_000045264.1.25833 WP_000045264.1.25835 WP_000045264.1.25882 WP_000045264.1.25911 WP_000045264.1.25962 WP_000045264.1.25963 WP_000045264.1.26001 WP_000045264.1.26027 WP_000045264.1.26107 WP_000045264.1.2615 WP_000045264.1.26217 WP_000045264.1.26230 WP_000045264.1.26232 WP_000045264.1.26272 WP_000045264.1.26286 WP_000045264.1.26288 WP_000045264.1.26394 WP_000045264.1.26491 WP_000045264.1.2654 WP_000045264.1.26554 WP_000045264.1.26636 WP_000045264.1.26689 WP_000045264.1.2679 WP_000045264.1.26908 WP_000045264.1.2692 WP_000045264.1.26928 WP_000045264.1.270 WP_000045264.1.27008 WP_000045264.1.27027 WP_000045264.1.27070 WP_000045264.1.27077 WP_000045264.1.27086 WP_000045264.1.27087 WP_000045264.1.27111 WP_000045264.1.27115 WP_000045264.1.2717 WP_000045264.1.27228 WP_000045264.1.27282 WP_000045264.1.27285 WP_000045264.1.27309 WP_000045264.1.27329 WP_000045264.1.27361 WP_000045264.1.27565 WP_000045264.1.27595 WP_000045264.1.27598 WP_000045264.1.27706 WP_000045264.1.27775 WP_000045264.1.27785 WP_000045264.1.27900 WP_000045264.1.27928 WP_000045264.1.27945 WP_000045264.1.27997 WP_000045264.1.28004 WP_000045264.1.2809 WP_000045264.1.28155 WP_000045264.1.28198 WP_000045264.1.2822 WP_000045264.1.28229 WP_000045264.1.28384 WP_000045264.1.28386 WP_000045264.1.28395 WP_000045264.1.284 WP_000045264.1.2845 WP_000045264.1.28479 WP_000045264.1.28627 WP_000045264.1.28692 WP_000045264.1.2873 WP_000045264.1.28917 WP_000045264.1.28962 WP_000045264.1.29023 WP_000045264.1.29042 WP_000045264.1.2905 WP_000045264.1.2907 WP_000045264.1.29089 WP_000045264.1.29153 WP_000045264.1.29203 WP_000045264.1.29237 WP_000045264.1.29248 WP_000045264.1.29288 WP_000045264.1.29389 WP_000045264.1.29439 WP_000045264.1.2946 WP_000045264.1.29462 WP_000045264.1.29727 WP_000045264.1.29743 WP_000045264.1.29782 WP_000045264.1.29833 WP_000045264.1.29851 WP_000045264.1.29865 WP_000045264.1.29886 WP_000045264.1.29919 WP_000045264.1.2994 WP_000045264.1.29964 WP_000045264.1.29983 WP_000045264.1.30009 WP_000045264.1.30013 WP_000045264.1.3002 WP_000045264.1.30034 WP_000045264.1.30049 WP_000045264.1.30058 WP_000045264.1.30172 WP_000045264.1.30185 WP_000045264.1.30354 WP_000045264.1.30357 WP_000045264.1.30362 WP_000045264.1.3042 WP_000045264.1.30421 WP_000045264.1.30440 WP_000045264.1.30448 WP_000045264.1.30489 WP_000045264.1.30517 WP_000045264.1.30542 WP_000045264.1.30544 WP_000045264.1.30556 WP_000045264.1.30572 WP_000045264.1.30585 WP_000045264.1.30618 WP_000045264.1.30619 WP_000045264.1.30664 WP_000045264.1.30688 WP_000045264.1.30806 WP_000045264.1.30967 WP_000045264.1.31046 WP_000045264.1.31066 WP_000045264.1.31078 WP_000045264.1.31139 WP_000045264.1.31145 WP_000045264.1.31182 WP_000045264.1.31205 WP_000045264.1.3121 WP_000045264.1.31223 WP_000045264.1.31303 WP_000045264.1.3131 WP_000045264.1.31352 WP_000045264.1.31389 WP_000045264.1.31413 WP_000045264.1.31446 WP_000045264.1.31533 WP_000045264.1.31799 WP_000045264.1.31836 WP_000045264.1.31951 WP_000045264.1.32041 WP_000045264.1.32042 WP_000045264.1.3207 WP_000045264.1.32189 WP_000045264.1.32202 WP_000045264.1.32263 WP_000045264.1.32293 WP_000045264.1.32299 WP_000045264.1.32422 WP_000045264.1.32425 WP_000045264.1.32434 WP_000045264.1.32458 WP_000045264.1.32460 WP_000045264.1.32529 WP_000045264.1.32563 WP_000045264.1.32578 WP_000045264.1.32617 WP_000045264.1.3270 WP_000045264.1.32725 WP_000045264.1.32838 WP_000045264.1.32848 WP_000045264.1.32868 WP_000045264.1.3290 WP_000045264.1.32940 WP_000045264.1.32941 WP_000045264.1.3296 WP_000045264.1.32966 WP_000045264.1.32985 WP_000045264.1.33037 WP_000045264.1.3305 WP_000045264.1.33051 WP_000045264.1.33065 WP_000045264.1.33122 WP_000045264.1.3315 WP_000045264.1.33208 WP_000045264.1.33214 WP_000045264.1.33247 WP_000045264.1.33280 WP_000045264.1.33283 WP_000045264.1.33313 WP_000045264.1.33339 WP_000045264.1.33382 WP_000045264.1.33490 WP_000045264.1.33501 WP_000045264.1.33529 WP_000045264.1.33689 WP_000045264.1.3370 WP_000045264.1.33730 WP_000045264.1.33741 WP_000045264.1.33840 WP_000045264.1.3392 WP_000045264.1.33926 WP_000045264.1.33957 WP_000045264.1.33969 WP_000045264.1.34001 WP_000045264.1.34118 WP_000045264.1.34211 WP_000045264.1.34214 WP_000045264.1.34234 WP_000045264.1.34284 WP_000045264.1.34376 WP_000045264.1.34382 WP_000045264.1.34484 WP_000045264.1.34496 WP_000045264.1.34517 WP_000045264.1.34530 WP_000045264.1.34665 WP_000045264.1.34694 WP_000045264.1.34751 WP_000045264.1.34808 WP_000045264.1.34824 WP_000045264.1.34834 WP_000045264.1.3489 WP_000045264.1.34932 WP_000045264.1.34962 WP_000045264.1.35001 WP_000045264.1.35040 WP_000045264.1.35074 WP_000045264.1.35175 WP_000045264.1.35240 WP_000045264.1.35274 WP_000045264.1.35532 WP_000045264.1.35560 WP_000045264.1.3557 WP_000045264.1.35628 WP_000045264.1.3570 WP_000045264.1.35712 WP_000045264.1.35713 WP_000045264.1.35736 WP_000045264.1.35791 WP_000045264.1.35795 WP_000045264.1.35870 WP_000045264.1.35916 WP_000045264.1.35938 WP_000045264.1.35966 WP_000045264.1.36000 WP_000045264.1.36034 WP_000045264.1.36036 WP_000045264.1.36069 WP_000045264.1.36291 WP_000045264.1.36298 WP_000045264.1.36308 WP_000045264.1.36323 WP_000045264.1.36343 WP_000045264.1.36460 WP_000045264.1.3649 WP_000045264.1.36495 WP_000045264.1.36526 WP_000045264.1.36567 WP_000045264.1.36579 WP_000045264.1.36617 WP_000045264.1.36618 WP_000045264.1.36643 WP_000045264.1.36663 WP_000045264.1.36701 WP_000045264.1.36725 WP_000045264.1.36751 WP_000045264.1.36779 WP_000045264.1.36798 WP_000045264.1.36802 WP_000045264.1.36821 WP_000045264.1.36853 WP_000045264.1.36950 WP_000045264.1.37014 WP_000045264.1.37133 WP_000045264.1.37176 WP_000045264.1.37199 WP_000045264.1.37200 WP_000045264.1.37258 WP_000045264.1.37303 WP_000045264.1.37513 WP_000045264.1.37584 WP_000045264.1.37590 WP_000045264.1.37593 WP_000045264.1.37600 WP_000045264.1.37613 WP_000045264.1.37659 WP_000045264.1.37662 WP_000045264.1.37675 WP_000045264.1.37691 WP_000045264.1.37761 WP_000045264.1.37775 WP_000045264.1.37777 WP_000045264.1.378 WP_000045264.1.379 WP_000045264.1.37911 WP_000045264.1.37941 WP_000045264.1.37985 WP_000045264.1.38061 WP_000045264.1.38064 WP_000045264.1.38108 WP_000045264.1.3816 WP_000045264.1.38207 WP_000045264.1.38261 WP_000045264.1.38266 WP_000045264.1.38273 WP_000045264.1.38310 WP_000045264.1.3834 WP_000045264.1.38351 WP_000045264.1.3838 WP_000045264.1.38381 WP_000045264.1.38440 WP_000045264.1.38486 WP_000045264.1.38515 WP_000045264.1.38595 WP_000045264.1.3860 WP_000045264.1.38642 WP_000045264.1.38734 WP_000045264.1.38877 WP_000045264.1.3891 WP_000045264.1.38983 WP_000045264.1.38996 WP_000045264.1.39038 WP_000045264.1.39056 WP_000045264.1.3907 WP_000045264.1.39105 WP_000045264.1.3914 WP_000045264.1.39147 WP_000045264.1.39161 WP_000045264.1.39210 WP_000045264.1.39235 WP_000045264.1.3931 WP_000045264.1.39435 WP_000045264.1.39502 WP_000045264.1.39530 WP_000045264.1.39619 WP_000045264.1.39620 WP_000045264.1.39624 WP_000045264.1.39659 WP_000045264.1.39667 WP_000045264.1.39775 WP_000045264.1.39879 WP_000045264.1.39890 WP_000045264.1.39941 WP_000045264.1.39945 WP_000045264.1.39947 WP_000045264.1.40095 WP_000045264.1.40097 WP_000045264.1.401 WP_000045264.1.40111 WP_000045264.1.40160 WP_000045264.1.40167 WP_000045264.1.40279 WP_000045264.1.40361 WP_000045264.1.4042 WP_000045264.1.40467 WP_000045264.1.40496 WP_000045264.1.40517 WP_000045264.1.40698 WP_000045264.1.40750 WP_000045264.1.40763 WP_000045264.1.40854 WP_000045264.1.4089 WP_000045264.1.40924 WP_000045264.1.40932 WP_000045264.1.40946 WP_000045264.1.41004 WP_000045264.1.4106 WP_000045264.1.41070 WP_000045264.1.41074 WP_000045264.1.41075 WP_000045264.1.41097 WP_000045264.1.41132 WP_000045264.1.41176 WP_000045264.1.41251 WP_000045264.1.41258 WP_000045264.1.41305 WP_000045264.1.41321 WP_000045264.1.41333 WP_000045264.1.41335 WP_000045264.1.4136 WP_000045264.1.41415 WP_000045264.1.41459 WP_000045264.1.41498 WP_000045264.1.41519 WP_000045264.1.41524 WP_000045264.1.41631 WP_000045264.1.41658 WP_000045264.1.41659 WP_000045264.1.41716 WP_000045264.1.41746 WP_000045264.1.4178 WP_000045264.1.41824 WP_000045264.1.41825 WP_000045264.1.41836 WP_000045264.1.41894 WP_000045264.1.41919 WP_000045264.1.41929 WP_000045264.1.4194 WP_000045264.1.42069 WP_000045264.1.42081 WP_000045264.1.42090 WP_000045264.1.42111 WP_000045264.1.42187 WP_000045264.1.42200 WP_000045264.1.42219 WP_000045264.1.42257 WP_000045264.1.42261 WP_000045264.1.42349 WP_000045264.1.42364 WP_000045264.1.42371 WP_000045264.1.42379 WP_000045264.1.42391 WP_000045264.1.42399 WP_000045264.1.42539 WP_000045264.1.42603 WP_000045264.1.42650 WP_000045264.1.4267 WP_000045264.1.42685 WP_000045264.1.42701 WP_000045264.1.42805 WP_000045264.1.42815 WP_000045264.1.42859 WP_000045264.1.4298 WP_000045264.1.43008 WP_000045264.1.43016 WP_000045264.1.43019 WP_000045264.1.43065 WP_000045264.1.43068 WP_000045264.1.43069 WP_000045264.1.43141 WP_000045264.1.43157 WP_000045264.1.43161 WP_000045264.1.43190 WP_000045264.1.43198 WP_000045264.1.4326 WP_000045264.1.43290 WP_000045264.1.43292 WP_000045264.1.43307 WP_000045264.1.43508 WP_000045264.1.43513 WP_000045264.1.43633 WP_000045264.1.43637 WP_000045264.1.43651 WP_000045264.1.43722 WP_000045264.1.43801 WP_000045264.1.43812 WP_000045264.1.43878 WP_000045264.1.43888 WP_000045264.1.43919 WP_000045264.1.43974 WP_000045264.1.44049 WP_000045264.1.44101 WP_000045264.1.44160 WP_000045264.1.44180 WP_000045264.1.44196 WP_000045264.1.44248 WP_000045264.1.44262 WP_000045264.1.44268 WP_000045264.1.4427 WP_000045264.1.44296 WP_000045264.1.44343 WP_000045264.1.44351 WP_000045264.1.44360 WP_000045264.1.44416 WP_000045264.1.44431 WP_000045264.1.44437 WP_000045264.1.44546 WP_000045264.1.4468 WP_000045264.1.44762 WP_000045264.1.44815 WP_000045264.1.44828 WP_000045264.1.44879 WP_000045264.1.44917 WP_000045264.1.4501 WP_000045264.1.45072 WP_000045264.1.45093 WP_000045264.1.45136 WP_000045264.1.45241 WP_000045264.1.45435 WP_000045264.1.45523 WP_000045264.1.45596 WP_000045264.1.45648 WP_000045264.1.45829 WP_000045264.1.45871 WP_000045264.1.46030 WP_000045264.1.46077 WP_000045264.1.46169 WP_000045264.1.46225 WP_000045264.1.46241 WP_000045264.1.46307 WP_000045264.1.46355 WP_000045264.1.464 WP_000045264.1.46454 WP_000045264.1.46461 WP_000045264.1.46504 WP_000045264.1.46505 WP_000045264.1.46551 WP_000045264.1.46559 WP_000045264.1.46701 WP_000045264.1.46781 WP_000045264.1.46816 WP_000045264.1.46842 WP_000045264.1.4690 WP_000045264.1.46920 WP_000045264.1.46945 WP_000045264.1.47036 WP_000045264.1.47037 WP_000045264.1.47042 WP_000045264.1.47059 WP_000045264.1.47085 WP_000045264.1.47123 WP_000045264.1.47215 WP_000045264.1.47257 WP_000045264.1.47523 WP_000045264.1.47531 WP_000045264.1.47532 WP_000045264.1.47605 WP_000045264.1.47630 WP_000045264.1.4774 WP_000045264.1.47756 WP_000045264.1.4781 WP_000045264.1.47886 WP_000045264.1.47898 WP_000045264.1.47928 WP_000045264.1.48019 WP_000045264.1.48100 WP_000045264.1.48114 WP_000045264.1.48139 WP_000045264.1.48190 WP_000045264.1.48292 WP_000045264.1.48324 WP_000045264.1.48426 WP_000045264.1.48430 WP_000045264.1.48436 WP_000045264.1.48455 WP_000045264.1.48586 WP_000045264.1.4859 WP_000045264.1.48591 WP_000045264.1.48610 WP_000045264.1.48631 WP_000045264.1.48663 WP_000045264.1.48690 WP_000045264.1.48734 WP_000045264.1.48756 WP_000045264.1.48778 WP_000045264.1.48849 WP_000045264.1.48955 WP_000045264.1.48963 WP_000045264.1.48973 WP_000045264.1.49004 WP_000045264.1.49106 WP_000045264.1.49117 WP_000045264.1.49121 WP_000045264.1.49140 WP_000045264.1.49153 WP_000045264.1.49166 WP_000045264.1.49233 WP_000045264.1.49429 WP_000045264.1.49434 WP_000045264.1.49450 WP_000045264.1.495 WP_000045264.1.49545 WP_000045264.1.49703 WP_000045264.1.49769 WP_000045264.1.49846 WP_000045264.1.4991 WP_000045264.1.49947 WP_000045264.1.49959 WP_000045264.1.49997 WP_000045264.1.50014 WP_000045264.1.50030 WP_000045264.1.50043 WP_000045264.1.50103 WP_000045264.1.50158 WP_000045264.1.50239 WP_000045264.1.50247 WP_000045264.1.50308 WP_000045264.1.50309 WP_000045264.1.50387 WP_000045264.1.50406 WP_000045264.1.50468 WP_000045264.1.5051 WP_000045264.1.50566 WP_000045264.1.50570 WP_000045264.1.50626 WP_000045264.1.50726 WP_000045264.1.50771 WP_000045264.1.50875 WP_000045264.1.509 WP_000045264.1.50929 WP_000045264.1.50970 WP_000045264.1.51040 WP_000045264.1.51048 WP_000045264.1.51100 WP_000045264.1.51134 WP_000045264.1.51227 WP_000045264.1.5127 WP_000045264.1.51305 WP_000045264.1.51315 WP_000045264.1.5136 WP_000045264.1.51474 WP_000045264.1.51519 WP_000045264.1.51598 WP_000045264.1.51724 WP_000045264.1.51734 WP_000045264.1.51838 WP_000045264.1.51863 WP_000045264.1.51935 WP_000045264.1.52057 WP_000045264.1.52129 WP_000045264.1.5216 WP_000045264.1.52191 WP_000045264.1.52202 WP_000045264.1.52209 WP_000045264.1.52339 WP_000045264.1.52469 WP_000045264.1.52571 WP_000045264.1.526 WP_000045264.1.52647 WP_000045264.1.52742 WP_000045264.1.52773 WP_000045264.1.52795 WP_000045264.1.52807 WP_000045264.1.52887 WP_000045264.1.53141 WP_000045264.1.53151 WP_000045264.1.53154 WP_000045264.1.53159 WP_000045264.1.53206 WP_000045264.1.53210 WP_000045264.1.53233 WP_000045264.1.53307 WP_000045264.1.53321 WP_000045264.1.53368 WP_000045264.1.53375 WP_000045264.1.53450 WP_000045264.1.53454 WP_000045264.1.5349 WP_000045264.1.53540 WP_000045264.1.53555 WP_000045264.1.53559 WP_000045264.1.5356 WP_000045264.1.53571 WP_000045264.1.5358 WP_000045264.1.53692 WP_000045264.1.53723 WP_000045264.1.5374 WP_000045264.1.53750 WP_000045264.1.53800 WP_000045264.1.53815 WP_000045264.1.53839 WP_000045264.1.53892 WP_000045264.1.53902 WP_000045264.1.53958 WP_000045264.1.53981 WP_000045264.1.53984 WP_000045264.1.54132 WP_000045264.1.54170 WP_000045264.1.54175 WP_000045264.1.54203 WP_000045264.1.54259 WP_000045264.1.5430 WP_000045264.1.54371 WP_000045264.1.54431 WP_000045264.1.54442 WP_000045264.1.54482 WP_000045264.1.54589 WP_000045264.1.54667 WP_000045264.1.54678 WP_000045264.1.54681 WP_000045264.1.54748 WP_000045264.1.5481 WP_000045264.1.54865 WP_000045264.1.54935 WP_000045264.1.54979 WP_000045264.1.55010 WP_000045264.1.55034 WP_000045264.1.55163 WP_000045264.1.55165 WP_000045264.1.55215 WP_000045264.1.55310 WP_000045264.1.55317 WP_000045264.1.55379 WP_000045264.1.5539 WP_000045264.1.55468 WP_000045264.1.55604 WP_000045264.1.55639 WP_000045264.1.55699 WP_000045264.1.55725 WP_000045264.1.55780 WP_000045264.1.55967 WP_000045264.1.56100 WP_000045264.1.56144 WP_000045264.1.56172 WP_000045264.1.5621 WP_000045264.1.56226 WP_000045264.1.56305 WP_000045264.1.56311 WP_000045264.1.56419 WP_000045264.1.56423 WP_000045264.1.56514 WP_000045264.1.56535 WP_000045264.1.56585 WP_000045264.1.56640 WP_000045264.1.56724 WP_000045264.1.56825 WP_000045264.1.56887 WP_000045264.1.56889 WP_000045264.1.56981 WP_000045264.1.57101 WP_000045264.1.57147 WP_000045264.1.57179 WP_000045264.1.57186 WP_000045264.1.57342 WP_000045264.1.57641 WP_000045264.1.57684 WP_000045264.1.57699 WP_000045264.1.57785 WP_000045264.1.57800 WP_000045264.1.57873 WP_000045264.1.57965 WP_000045264.1.57972 WP_000045264.1.58008 WP_000045264.1.58044 WP_000045264.1.58081 WP_000045264.1.5809 WP_000045264.1.58132 WP_000045264.1.58173 WP_000045264.1.58191 WP_000045264.1.58194 WP_000045264.1.58252 WP_000045264.1.58261 WP_000045264.1.58274 WP_000045264.1.58282 WP_000045264.1.58324 WP_000045264.1.58326 WP_000045264.1.5836 WP_000045264.1.58485 WP_000045264.1.58537 WP_000045264.1.58568 WP_000045264.1.58583 WP_000045264.1.58652 WP_000045264.1.58663 WP_000045264.1.58724 WP_000045264.1.5875 WP_000045264.1.58796 WP_000045264.1.58807 WP_000045264.1.58847 WP_000045264.1.58883 WP_000045264.1.58898 WP_000045264.1.58932 WP_000045264.1.58949 WP_000045264.1.58963 WP_000045264.1.58970 WP_000045264.1.58974 WP_000045264.1.59020 WP_000045264.1.59043 WP_000045264.1.59056 WP_000045264.1.59061 WP_000045264.1.59064 WP_000045264.1.59282 WP_000045264.1.59299 WP_000045264.1.59313 WP_000045264.1.5949 WP_000045264.1.59501 WP_000045264.1.59510 WP_000045264.1.5969 WP_000045264.1.59751 WP_000045264.1.59827 WP_000045264.1.59829 WP_000045264.1.59847 WP_000045264.1.59863 WP_000045264.1.59969 WP_000045264.1.59994 WP_000045264.1.60004 WP_000045264.1.60045 WP_000045264.1.60052 WP_000045264.1.60076 WP_000045264.1.60114 WP_000045264.1.60154 WP_000045264.1.60168 WP_000045264.1.60192 WP_000045264.1.60199 WP_000045264.1.60212 WP_000045264.1.60253 WP_000045264.1.60322 WP_000045264.1.60324 WP_000045264.1.60356 WP_000045264.1.6038 WP_000045264.1.60380 WP_000045264.1.6041 WP_000045264.1.60424 WP_000045264.1.60481 WP_000045264.1.605 WP_000045264.1.6058 WP_000045264.1.60584 WP_000045264.1.6060 WP_000045264.1.60643 WP_000045264.1.60676 WP_000045264.1.60708 WP_000045264.1.60725 WP_000045264.1.60783 WP_000045264.1.60792 WP_000045264.1.60807 WP_000045264.1.60882 WP_000045264.1.60889 WP_000045264.1.60950 WP_000045264.1.6104 WP_000045264.1.61044 WP_000045264.1.61076 WP_000045264.1.61123 WP_000045264.1.61147 WP_000045264.1.61168 WP_000045264.1.61210 WP_000045264.1.61357 WP_000045264.1.61511 WP_000045264.1.61539 WP_000045264.1.61542 WP_000045264.1.61553 WP_000045264.1.61649 WP_000045264.1.61652 WP_000045264.1.61697 WP_000045264.1.61809 WP_000045264.1.61877 WP_000045264.1.61920 WP_000045264.1.62124 WP_000045264.1.62199 WP_000045264.1.62223 WP_000045264.1.62302 WP_000045264.1.62314 WP_000045264.1.62323 WP_000045264.1.62333 WP_000045264.1.62338 WP_000045264.1.62380 WP_000045264.1.62411 WP_000045264.1.62436 WP_000045264.1.62475 WP_000045264.1.62536 WP_000045264.1.62640 WP_000045264.1.62686 WP_000045264.1.62751 WP_000045264.1.62825 WP_000045264.1.62913 WP_000045264.1.62932 WP_000045264.1.62960 WP_000045264.1.63016 WP_000045264.1.63025 WP_000045264.1.63069 WP_000045264.1.63087 WP_000045264.1.63169 WP_000045264.1.63297 WP_000045264.1.63448 WP_000045264.1.63514 WP_000045264.1.63583 WP_000045264.1.63592 WP_000045264.1.63663 WP_000045264.1.63677 WP_000045264.1.63736 WP_000045264.1.63816 WP_000045264.1.63876 WP_000045264.1.6389 WP_000045264.1.63901 WP_000045264.1.63955 WP_000045264.1.63963 WP_000045264.1.64032 WP_000045264.1.64087 WP_000045264.1.6415 WP_000045264.1.64293 WP_000045264.1.64332 WP_000045264.1.64376 WP_000045264.1.644 WP_000045264.1.64412 WP_000045264.1.64471 WP_000045264.1.64501 WP_000045264.1.64538 WP_000045264.1.64632 WP_000045264.1.64648 WP_000045264.1.64654 WP_000045264.1.64662 WP_000045264.1.64663 WP_000045264.1.64667 WP_000045264.1.64709 WP_000045264.1.64710 WP_000045264.1.64744 WP_000045264.1.64817 WP_000045264.1.64847 WP_000045264.1.6487 WP_000045264.1.64891 WP_000045264.1.64974 WP_000045264.1.65054 WP_000045264.1.65075 WP_000045264.1.6514 WP_000045264.1.65163 WP_000045264.1.65172 WP_000045264.1.65191 WP_000045264.1.65200 WP_000045264.1.65211 WP_000045264.1.65218 WP_000045264.1.65226 WP_000045264.1.65249 WP_000045264.1.65266 WP_000045264.1.65395 WP_000045264.1.65459 WP_000045264.1.65463 WP_000045264.1.65487 WP_000045264.1.6549 WP_000045264.1.65499 WP_000045264.1.6554 WP_000045264.1.65650 WP_000045264.1.65697 WP_000045264.1.65699 WP_000045264.1.65737 WP_000045264.1.65755 WP_000045264.1.65812 WP_000045264.1.65846 WP_000045264.1.65863 WP_000045264.1.65985 WP_000045264.1.66021 WP_000045264.1.66031 WP_000045264.1.66052 WP_000045264.1.66064 WP_000045264.1.66109 WP_000045264.1.66145 WP_000045264.1.66183 WP_000045264.1.6620 WP_000045264.1.66216 WP_000045264.1.66270 WP_000045264.1.66273 WP_000045264.1.66324 WP_000045264.1.6634 WP_000045264.1.66361 WP_000045264.1.66480 WP_000045264.1.66506 WP_000045264.1.66665 WP_000045264.1.66681 WP_000045264.1.66684 WP_000045264.1.66755 WP_000045264.1.66759 WP_000045264.1.66801 WP_000045264.1.66860 WP_000045264.1.6692 WP_000045264.1.66953 WP_000045264.1.66955 WP_000045264.1.66981 WP_000045264.1.67024 WP_000045264.1.67042 WP_000045264.1.67101 WP_000045264.1.67143 WP_000045264.1.67201 WP_000045264.1.67211 WP_000045264.1.67237 WP_000045264.1.67336 WP_000045264.1.67339 WP_000045264.1.67387 WP_000045264.1.67394 WP_000045264.1.67397 WP_000045264.1.67403 WP_000045264.1.67430 WP_000045264.1.67442 WP_000045264.1.67539 WP_000045264.1.67556 WP_000045264.1.67576 WP_000045264.1.67604 WP_000045264.1.67619 WP_000045264.1.67625 WP_000045264.1.67627 WP_000045264.1.67641 WP_000045264.1.67657 WP_000045264.1.67673 WP_000045264.1.67700 WP_000045264.1.67718 WP_000045264.1.67729 WP_000045264.1.67774 WP_000045264.1.67820 WP_000045264.1.67910 WP_000045264.1.67954 WP_000045264.1.68 WP_000045264.1.68043 WP_000045264.1.68105 WP_000045264.1.68113 WP_000045264.1.68131 WP_000045264.1.68182 WP_000045264.1.6819 WP_000045264.1.68285 WP_000045264.1.68359 WP_000045264.1.68420 WP_000045264.1.68514 WP_000045264.1.68564 WP_000045264.1.68688 WP_000045264.1.68742 WP_000045264.1.6875 WP_000045264.1.68770 WP_000045264.1.68809 WP_000045264.1.68914 WP_000045264.1.69053 WP_000045264.1.69170 WP_000045264.1.69210 WP_000045264.1.69270 WP_000045264.1.69282 WP_000045264.1.69371 WP_000045264.1.69376 WP_000045264.1.69396 WP_000045264.1.69465 WP_000045264.1.69466 WP_000045264.1.69611 WP_000045264.1.69642 WP_000045264.1.69656 WP_000045264.1.69657 WP_000045264.1.69690 WP_000045264.1.69754 WP_000045264.1.69890 WP_000045264.1.69923 WP_000045264.1.69948 WP_000045264.1.69953 WP_000045264.1.70010 WP_000045264.1.70049 WP_000045264.1.70058 WP_000045264.1.70061 WP_000045264.1.70205 WP_000045264.1.70240 WP_000045264.1.70249 WP_000045264.1.70261 WP_000045264.1.70314 WP_000045264.1.7033 WP_000045264.1.70427 WP_000045264.1.70433 WP_000045264.1.70545 WP_000045264.1.70623 WP_000045264.1.70671 WP_000045264.1.70679 WP_000045264.1.70708 WP_000045264.1.70717 WP_000045264.1.70731 WP_000045264.1.70772 WP_000045264.1.70845 WP_000045264.1.70846 WP_000045264.1.70981 WP_000045264.1.70995 WP_000045264.1.71039 WP_000045264.1.71057 WP_000045264.1.71081 WP_000045264.1.71117 WP_000045264.1.71186 WP_000045264.1.71455 WP_000045264.1.71456 WP_000045264.1.71487 WP_000045264.1.71523 WP_000045264.1.71542 WP_000045264.1.71566 WP_000045264.1.71640 WP_000045264.1.71651 WP_000045264.1.71653 WP_000045264.1.71716 WP_000045264.1.71872 WP_000045264.1.71950 WP_000045264.1.71954 WP_000045264.1.71985 WP_000045264.1.72003 WP_000045264.1.72073 WP_000045264.1.72269 WP_000045264.1.72350 WP_000045264.1.72383 WP_000045264.1.72461 WP_000045264.1.72527 WP_000045264.1.7255 WP_000045264.1.72631 WP_000045264.1.72638 WP_000045264.1.72667 WP_000045264.1.72674 WP_000045264.1.72724 WP_000045264.1.72789 WP_000045264.1.72828 WP_000045264.1.72896 WP_000045264.1.72969 WP_000045264.1.72987 WP_000045264.1.7304 WP_000045264.1.73052 WP_000045264.1.7311 WP_000045264.1.73114 WP_000045264.1.73177 WP_000045264.1.73180 WP_000045264.1.73258 WP_000045264.1.73285 WP_000045264.1.7332 WP_000045264.1.7333 WP_000045264.1.73352 WP_000045264.1.73389 WP_000045264.1.73425 WP_000045264.1.73488 WP_000045264.1.73504 WP_000045264.1.7353 WP_000045264.1.73535 WP_000045264.1.73544 WP_000045264.1.73598 WP_000045264.1.7361 WP_000045264.1.73648 WP_000045264.1.73768 WP_000045264.1.73849 WP_000045264.1.73948 WP_000045264.1.73999 WP_000045264.1.74024 WP_000045264.1.74030 WP_000045264.1.74038 WP_000045264.1.74043 WP_000045264.1.74058 WP_000045264.1.74070 WP_000045264.1.74077 WP_000045264.1.74135 WP_000045264.1.74214 WP_000045264.1.74285 WP_000045264.1.7430 WP_000045264.1.74317 WP_000045264.1.74402 WP_000045264.1.74415 WP_000045264.1.74616 WP_000045264.1.74621 WP_000045264.1.74644 WP_000045264.1.74647 WP_000045264.1.74699 WP_000045264.1.74702 WP_000045264.1.74894 WP_000045264.1.74929 WP_000045264.1.74939 WP_000045264.1.74973 WP_000045264.1.7507 WP_000045264.1.75089 WP_000045264.1.75116 WP_000045264.1.75237 WP_000045264.1.75273 WP_000045264.1.75296 WP_000045264.1.75413 WP_000045264.1.75433 WP_000045264.1.75532 WP_000045264.1.75565 WP_000045264.1.75593 WP_000045264.1.75610 WP_000045264.1.75633 WP_000045264.1.75718 WP_000045264.1.75745 WP_000045264.1.75844 WP_000045264.1.75886 WP_000045264.1.75898 WP_000045264.1.76081 WP_000045264.1.76116 WP_000045264.1.76122 WP_000045264.1.76256 WP_000045264.1.76339 WP_000045264.1.76366 WP_000045264.1.76417 WP_000045264.1.7646 WP_000045264.1.76510 WP_000045264.1.76558 WP_000045264.1.76572 WP_000045264.1.76641 WP_000045264.1.76651 WP_000045264.1.76653 WP_000045264.1.76788 WP_000045264.1.76854 WP_000045264.1.76916 WP_000045264.1.76932 WP_000045264.1.76973 WP_000045264.1.76988 WP_000045264.1.77016 WP_000045264.1.77087 WP_000045264.1.77090 WP_000045264.1.77111 WP_000045264.1.77299 WP_000045264.1.77384 WP_000045264.1.77501 WP_000045264.1.77512 WP_000045264.1.77513 WP_000045264.1.77563 WP_000045264.1.77565 WP_000045264.1.77702 WP_000045264.1.77713 WP_000045264.1.7772 WP_000045264.1.77729 WP_000045264.1.77825 WP_000045264.1.77837 WP_000045264.1.77846 WP_000045264.1.77900 WP_000045264.1.77923 WP_000045264.1.77975 WP_000045264.1.78035 WP_000045264.1.78048 WP_000045264.1.78107 WP_000045264.1.78166 WP_000045264.1.78195 WP_000045264.1.78291 WP_000045264.1.78309 WP_000045264.1.78320 WP_000045264.1.78382 WP_000045264.1.78388 WP_000045264.1.78410 WP_000045264.1.7862 WP_000045264.1.78626 WP_000045264.1.78661 WP_000045264.1.78674 WP_000045264.1.78676 WP_000045264.1.78761 WP_000045264.1.789 WP_000045264.1.78993 WP_000045264.1.79012 WP_000045264.1.79069 WP_000045264.1.79074 WP_000045264.1.79098 WP_000045264.1.79155 WP_000045264.1.79164 WP_000045264.1.79204 WP_000045264.1.79235 WP_000045264.1.79280 WP_000045264.1.79397 WP_000045264.1.79456 WP_000045264.1.79532 WP_000045264.1.79547 WP_000045264.1.79654 WP_000045264.1.7970 WP_000045264.1.79722 WP_000045264.1.79772 WP_000045264.1.79880 WP_000045264.1.79916 WP_000045264.1.80065 WP_000045264.1.80103 WP_000045264.1.80273 WP_000045264.1.80282 WP_000045264.1.80354 WP_000045264.1.80368 WP_000045264.1.80386 WP_000045264.1.80400 WP_000045264.1.80462 WP_000045264.1.8049 WP_000045264.1.80492 WP_000045264.1.80569 WP_000045264.1.80664 WP_000045264.1.80696 WP_000045264.1.80913 WP_000045264.1.80984 WP_000045264.1.81131 WP_000045264.1.81187 WP_000045264.1.81262 WP_000045264.1.81268 WP_000045264.1.81269 WP_000045264.1.81271 WP_000045264.1.8131 WP_000045264.1.81333 WP_000045264.1.81342 WP_000045264.1.81364 WP_000045264.1.81472 WP_000045264.1.81494 WP_000045264.1.81557 WP_000045264.1.81676 WP_000045264.1.8170 WP_000045264.1.81763 WP_000045264.1.81855 WP_000045264.1.81921 WP_000045264.1.81931 WP_000045264.1.81936 WP_000045264.1.81949 WP_000045264.1.82070 WP_000045264.1.82076 WP_000045264.1.82131 WP_000045264.1.82156 WP_000045264.1.8218 WP_000045264.1.82180 WP_000045264.1.82201 WP_000045264.1.82214 WP_000045264.1.82225 WP_000045264.1.8240 WP_000045264.1.82416 WP_000045264.1.8242 WP_000045264.1.82456 WP_000045264.1.82465 WP_000045264.1.82473 WP_000045264.1.82553 WP_000045264.1.82584 WP_000045264.1.82646 WP_000045264.1.82670 WP_000045264.1.82731 WP_000045264.1.82763 WP_000045264.1.82812 WP_000045264.1.82850 WP_000045264.1.82872 WP_000045264.1.8294 WP_000045264.1.82959 WP_000045264.1.83007 WP_000045264.1.8304 WP_000045264.1.83180 WP_000045264.1.83229 WP_000045264.1.83235 WP_000045264.1.83290 WP_000045264.1.83333 WP_000045264.1.83657 WP_000045264.1.83677 WP_000045264.1.8375 WP_000045264.1.83923 WP_000045264.1.83994 WP_000045264.1.84 WP_000045264.1.8406 WP_000045264.1.84076 WP_000045264.1.84110 WP_000045264.1.84127 WP_000045264.1.84150 WP_000045264.1.84230 WP_000045264.1.84252 WP_000045264.1.8431 WP_000045264.1.84345 WP_000045264.1.84369 WP_000045264.1.84401 WP_000045264.1.84435 WP_000045264.1.84567 WP_000045264.1.84631 WP_000045264.1.84727 WP_000045264.1.84744 WP_000045264.1.84773 WP_000045264.1.84945 WP_000045264.1.84967 WP_000045264.1.85004 WP_000045264.1.8502 WP_000045264.1.85039 WP_000045264.1.85126 WP_000045264.1.85153 WP_000045264.1.85273 WP_000045264.1.85338 WP_000045264.1.85339 WP_000045264.1.85469 WP_000045264.1.85511 WP_000045264.1.85512 WP_000045264.1.8557 WP_000045264.1.85606 WP_000045264.1.85635 WP_000045264.1.85646 WP_000045264.1.85665 WP_000045264.1.85669 WP_000045264.1.85688 WP_000045264.1.85703 WP_000045264.1.85728 WP_000045264.1.85746 WP_000045264.1.85811 WP_000045264.1.859 WP_000045264.1.85917 WP_000045264.1.8594 WP_000045264.1.85977 WP_000045264.1.860 WP_000045264.1.8605 WP_000045264.1.86084 WP_000045264.1.8610 WP_000045264.1.8614 WP_000045264.1.86156 WP_000045264.1.86310 WP_000045264.1.86316 WP_000045264.1.86323 WP_000045264.1.86342 WP_000045264.1.8640 WP_000045264.1.8642 WP_000045264.1.86489 WP_000045264.1.86530 WP_000045264.1.86663 WP_000045264.1.86770 WP_000045264.1.86794 WP_000045264.1.86800 WP_000045264.1.86811 WP_000045264.1.86945 WP_000045264.1.86989 WP_000045264.1.87023 WP_000045264.1.87034 WP_000045264.1.87041 WP_000045264.1.87136 WP_000045264.1.87155 WP_000045264.1.87258 WP_000045264.1.87293 WP_000045264.1.87420 WP_000045264.1.87528 WP_000045264.1.87560 WP_000045264.1.8760 WP_000045264.1.87600 WP_000045264.1.87609 WP_000045264.1.87612 WP_000045264.1.87615 WP_000045264.1.87653 WP_000045264.1.87698 WP_000045264.1.87706 WP_000045264.1.87739 WP_000045264.1.87741 WP_000045264.1.87742 WP_000045264.1.87852 WP_000045264.1.87949 WP_000045264.1.88025 WP_000045264.1.88026 WP_000045264.1.8805 WP_000045264.1.8806 WP_000045264.1.881 WP_000045264.1.88145 WP_000045264.1.88199 WP_000045264.1.88299 WP_000045264.1.88313 WP_000045264.1.88359 WP_000045264.1.88407 WP_000045264.1.88414 WP_000045264.1.88444 WP_000045264.1.88446 WP_000045264.1.88458 WP_000045264.1.88501 WP_000045264.1.88547 WP_000045264.1.886 WP_000045264.1.88647 WP_000045264.1.88648 WP_000045264.1.88692 WP_000045264.1.88707 WP_000045264.1.88727 WP_000045264.1.88772 WP_000045264.1.88850 WP_000045264.1.8889 WP_000045264.1.88892 WP_000045264.1.88894 WP_000045264.1.89182 WP_000045264.1.89298 WP_000045264.1.89308 WP_000045264.1.89314 WP_000045264.1.89328 WP_000045264.1.89332 WP_000045264.1.89343 WP_000045264.1.89395 WP_000045264.1.8940 WP_000045264.1.89449 WP_000045264.1.8947 WP_000045264.1.89503 WP_000045264.1.89591 WP_000045264.1.89612 WP_000045264.1.89668 WP_000045264.1.89706 WP_000045264.1.89713 WP_000045264.1.89733 WP_000045264.1.89796 WP_000045264.1.89804 WP_000045264.1.89845 WP_000045264.1.89888 WP_000045264.1.89911 WP_000045264.1.8995 WP_000045264.1.89952 WP_000045264.1.90007 WP_000045264.1.9011 WP_000045264.1.90196 WP_000045264.1.90240 WP_000045264.1.90274 WP_000045264.1.90280 WP_000045264.1.90330 WP_000045264.1.90338 WP_000045264.1.90363 WP_000045264.1.90365 WP_000045264.1.90428 WP_000045264.1.90489 WP_000045264.1.90513 WP_000045264.1.90582 WP_000045264.1.90701 WP_000045264.1.90713 WP_000045264.1.90794 WP_000045264.1.90796 WP_000045264.1.90811 WP_000045264.1.9091 WP_000045264.1.91067 WP_000045264.1.91164 WP_000045264.1.91205 WP_000045264.1.91239 WP_000045264.1.91291 WP_000045264.1.91313 WP_000045264.1.9135 WP_000045264.1.91506 WP_000045264.1.91557 WP_000045264.1.91597 WP_000045264.1.91715 WP_000045264.1.9187 WP_000045264.1.91870 WP_000045264.1.92018 WP_000045264.1.92087 WP_000045264.1.92098 WP_000045264.1.92156 WP_000045264.1.92172 WP_000045264.1.92240 WP_000045264.1.92243 WP_000045264.1.92299 WP_000045264.1.92327 WP_000045264.1.92470 WP_000045264.1.92477 WP_000045264.1.92545 WP_000045264.1.92570 WP_000045264.1.92588 WP_000045264.1.926 WP_000045264.1.92633 WP_000045264.1.92649 WP_000045264.1.92676 WP_000045264.1.92705 WP_000045264.1.9271 WP_000045264.1.92734 WP_000045264.1.92823 WP_000045264.1.92987 WP_000045264.1.93007 WP_000045264.1.93022 WP_000045264.1.93103 WP_000045264.1.93105 WP_000045264.1.93111 WP_000045264.1.93121 WP_000045264.1.93168 WP_000045264.1.93184 WP_000045264.1.93221 WP_000045264.1.93223 WP_000045264.1.93239 WP_000045264.1.93302 WP_000045264.1.9336 WP_000045264.1.93387 WP_000045264.1.93469 WP_000045264.1.93511 WP_000045264.1.93512 WP_000045264.1.93635 WP_000045264.1.93657 WP_000045264.1.9374 WP_000045264.1.9375 WP_000045264.1.93754 WP_000045264.1.93780 WP_000045264.1.93828 WP_000045264.1.93842 WP_000045264.1.93843 WP_000045264.1.93875 WP_000045264.1.93909 WP_000045264.1.93919 WP_000045264.1.93938 WP_000045264.1.93984 WP_000045264.1.9399 WP_000045264.1.94017 WP_000045264.1.94064 WP_000045264.1.94079 WP_000045264.1.94097 WP_000045264.1.94107 WP_000045264.1.94142 WP_000045264.1.94215 WP_000045264.1.94303 WP_000045264.1.94365 WP_000045264.1.94390 WP_000045264.1.94415 WP_000045264.1.94492 WP_000045264.1.94510 WP_000045264.1.94527 WP_000045264.1.94573 WP_000045264.1.94579 WP_000045264.1.94586 WP_000045264.1.94593 WP_000045264.1.94650 WP_000045264.1.94659 WP_000045264.1.94662 WP_000045264.1.94700 WP_000045264.1.94745 WP_000045264.1.94782 WP_000045264.1.94815 WP_000045264.1.94817 WP_000045264.1.94820 WP_000045264.1.94850 WP_000045264.1.94851 WP_000045264.1.94864 WP_000045264.1.94947 WP_000045264.1.94952 WP_000045264.1.95006 WP_000045264.1.95055 WP_000045264.1.95076 WP_000045264.1.95099 WP_000045264.1.95165 WP_000045264.1.95171 WP_000045264.1.95239 WP_000045264.1.95246 WP_000045264.1.9525 WP_000045264.1.95255 WP_000045264.1.95265 WP_000045264.1.95338 WP_000045264.1.95412 WP_000045264.1.95530 WP_000045264.1.95547 WP_000045264.1.95590 WP_000045264.1.95625 WP_000045264.1.95675 WP_000045264.1.95716 WP_000045264.1.95776 WP_000045264.1.95884 WP_000045264.1.95906 WP_000045264.1.96025 WP_000045264.1.96044 WP_000045264.1.96094 WP_000045264.1.96127 WP_000045264.1.96144 WP_000045264.1.96188 WP_000045264.1.96211 WP_000045264.1.96212 WP_000045264.1.96319 WP_000045264.1.9633 WP_000045264.1.96359 WP_000045264.1.96539 WP_000045264.1.96552 WP_000045264.1.96610 WP_000045264.1.96625 WP_000045264.1.96635 WP_000045264.1.9664 WP_000045264.1.96675 WP_000045264.1.9670 WP_000045264.1.96750 WP_000045264.1.96792 WP_000045264.1.96801 WP_000045264.1.96803 WP_000045264.1.96925 WP_000045264.1.96938 WP_000045264.1.96946 WP_000045264.1.96957 WP_000045264.1.96978 WP_000045264.1.97026 WP_000045264.1.97028 WP_000045264.1.97079 WP_000045264.1.97154 WP_000045264.1.97184 WP_000045264.1.97287 WP_000045264.1.97291 WP_000045264.1.97422 WP_000045264.1.97441 WP_000045264.1.97497 WP_000045264.1.97505 WP_000045264.1.97599 WP_000045264.1.97606 WP_000045264.1.97615 WP_000045264.1.97646 WP_000045264.1.97690 WP_000045264.1.97725 WP_000045264.1.97800 WP_000045264.1.97819 WP_000045264.1.97840 WP_000045264.1.97938 WP_000045264.1.97986 WP_000045264.1.98036 WP_000045264.1.98080 WP_000045264.1.98086 WP_000045264.1.98158 WP_000045264.1.98263 WP_000045264.1.98418 WP_000045264.1.98448 WP_000045264.1.98457 WP_000045264.1.9850 WP_000045264.1.98502 WP_000045264.1.98607 WP_000045264.1.98731 WP_000045264.1.98762 WP_000045264.1.9877 WP_000045264.1.98801 WP_000045264.1.98818 WP_000045264.1.99163 WP_000045264.1.99335 WP_000045264.1.99350 WP_000045264.1.99360 WP_000045264.1.99363 WP_000045264.1.99369 WP_000045264.1.99388 WP_000045264.1.99397 WP_000045264.1.99463 WP_000045264.1.99483 WP_000045264.1.99546 WP_000045264.1.99579 WP_000045264.1.99595 WP_000045264.1.99676 WP_000045264.1.99764 WP_000045264.1.99829 WP_000045264.1.99837 WP_000045264.1.99841 WP_000045264.1.9992 WP_000045264.1.99996 gi|29140743|ref|NP_804085.1| gi|488652764|ref|YP_007924567.1| gi|16759193|ref|NP_454810.1| 209261.t0203 220341.STY0223 gi|378958349|ref|YP_005215835.1| AE014613|CDS_235490-234210 AL513382|CDS_235499-234219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]