SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759408|ref|NP_455025.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759408|ref|NP_455025.1|
Domain Number 1 Region: 6-363
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.99e-86
Family Cystathionine synthase-like 0.00000000000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16759408|ref|NP_455025.1|
Sequence length 367
Comment 2-aminoethylphosphonate:pyruvate aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSV
LLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPNV
QAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDI
AALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSLSLDLYAQWRCMEDNHGKW
RFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPI
ITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIR
TAMYWTK
Download sequence
Identical sequences Q8Z8W6
gi|378960602|ref|YP_005218088.1| gi|16759408|ref|NP_455025.1| 209261.t2432 220341.STY0470 gi|29142820|ref|NP_806162.1| gi|488654926|ref|YP_007926729.1| AE014613|CDS_2504684-2503581 AL513382|CDS_476417-477520 NP_455025.1.84458 WP_000203965.1.100008 WP_000203965.1.100036 WP_000203965.1.100196 WP_000203965.1.100284 WP_000203965.1.100313 WP_000203965.1.100314 WP_000203965.1.100321 WP_000203965.1.100354 WP_000203965.1.100421 WP_000203965.1.100446 WP_000203965.1.100450 WP_000203965.1.100592 WP_000203965.1.100610 WP_000203965.1.100732 WP_000203965.1.100733 WP_000203965.1.100739 WP_000203965.1.100764 WP_000203965.1.100799 WP_000203965.1.100941 WP_000203965.1.100953 WP_000203965.1.101011 WP_000203965.1.10108 WP_000203965.1.101226 WP_000203965.1.10124 WP_000203965.1.101271 WP_000203965.1.101312 WP_000203965.1.101322 WP_000203965.1.101374 WP_000203965.1.101616 WP_000203965.1.101890 WP_000203965.1.101941 WP_000203965.1.102050 WP_000203965.1.102087 WP_000203965.1.10338 WP_000203965.1.1038 WP_000203965.1.104 WP_000203965.1.10401 WP_000203965.1.10428 WP_000203965.1.10459 WP_000203965.1.10475 WP_000203965.1.10511 WP_000203965.1.10514 WP_000203965.1.10530 WP_000203965.1.10547 WP_000203965.1.10595 WP_000203965.1.10642 WP_000203965.1.10654 WP_000203965.1.10677 WP_000203965.1.10857 WP_000203965.1.10873 WP_000203965.1.10926 WP_000203965.1.10936 WP_000203965.1.11012 WP_000203965.1.11126 WP_000203965.1.11142 WP_000203965.1.11239 WP_000203965.1.11253 WP_000203965.1.11314 WP_000203965.1.11385 WP_000203965.1.1142 WP_000203965.1.11426 WP_000203965.1.11429 WP_000203965.1.11557 WP_000203965.1.11567 WP_000203965.1.11638 WP_000203965.1.11883 WP_000203965.1.11908 WP_000203965.1.11914 WP_000203965.1.12040 WP_000203965.1.12061 WP_000203965.1.1207 WP_000203965.1.12141 WP_000203965.1.12172 WP_000203965.1.12192 WP_000203965.1.1224 WP_000203965.1.12364 WP_000203965.1.12398 WP_000203965.1.12441 WP_000203965.1.12581 WP_000203965.1.12620 WP_000203965.1.12648 WP_000203965.1.12683 WP_000203965.1.12726 WP_000203965.1.12727 WP_000203965.1.12741 WP_000203965.1.12834 WP_000203965.1.13108 WP_000203965.1.13161 WP_000203965.1.1321 WP_000203965.1.13268 WP_000203965.1.13291 WP_000203965.1.133 WP_000203965.1.13314 WP_000203965.1.13338 WP_000203965.1.13342 WP_000203965.1.13352 WP_000203965.1.13406 WP_000203965.1.13440 WP_000203965.1.13443 WP_000203965.1.13476 WP_000203965.1.13599 WP_000203965.1.13686 WP_000203965.1.1372 WP_000203965.1.13732 WP_000203965.1.1382 WP_000203965.1.1397 WP_000203965.1.13972 WP_000203965.1.140 WP_000203965.1.1401 WP_000203965.1.1408 WP_000203965.1.14089 WP_000203965.1.14099 WP_000203965.1.14123 WP_000203965.1.14150 WP_000203965.1.14191 WP_000203965.1.14197 WP_000203965.1.14280 WP_000203965.1.14333 WP_000203965.1.14399 WP_000203965.1.14444 WP_000203965.1.14467 WP_000203965.1.14474 WP_000203965.1.14500 WP_000203965.1.14526 WP_000203965.1.14550 WP_000203965.1.14575 WP_000203965.1.14701 WP_000203965.1.14703 WP_000203965.1.14719 WP_000203965.1.1473 WP_000203965.1.14765 WP_000203965.1.14810 WP_000203965.1.14877 WP_000203965.1.14894 WP_000203965.1.14930 WP_000203965.1.14947 WP_000203965.1.14948 WP_000203965.1.15184 WP_000203965.1.15265 WP_000203965.1.15362 WP_000203965.1.15415 WP_000203965.1.15423 WP_000203965.1.15433 WP_000203965.1.15439 WP_000203965.1.15487 WP_000203965.1.15535 WP_000203965.1.15581 WP_000203965.1.15597 WP_000203965.1.15710 WP_000203965.1.15717 WP_000203965.1.15905 WP_000203965.1.15912 WP_000203965.1.15970 WP_000203965.1.16046 WP_000203965.1.16051 WP_000203965.1.16058 WP_000203965.1.16150 WP_000203965.1.16155 WP_000203965.1.1626 WP_000203965.1.16264 WP_000203965.1.16344 WP_000203965.1.16452 WP_000203965.1.16461 WP_000203965.1.16462 WP_000203965.1.16465 WP_000203965.1.16522 WP_000203965.1.16588 WP_000203965.1.16658 WP_000203965.1.16666 WP_000203965.1.16673 WP_000203965.1.1674 WP_000203965.1.16767 WP_000203965.1.16781 WP_000203965.1.16879 WP_000203965.1.16893 WP_000203965.1.16905 WP_000203965.1.16948 WP_000203965.1.17049 WP_000203965.1.17058 WP_000203965.1.17078 WP_000203965.1.17202 WP_000203965.1.17219 WP_000203965.1.1722 WP_000203965.1.17302 WP_000203965.1.17308 WP_000203965.1.17368 WP_000203965.1.17405 WP_000203965.1.17406 WP_000203965.1.17513 WP_000203965.1.17543 WP_000203965.1.17563 WP_000203965.1.17578 WP_000203965.1.17622 WP_000203965.1.17659 WP_000203965.1.17667 WP_000203965.1.17686 WP_000203965.1.17741 WP_000203965.1.17840 WP_000203965.1.17956 WP_000203965.1.18005 WP_000203965.1.1801 WP_000203965.1.18021 WP_000203965.1.18099 WP_000203965.1.18124 WP_000203965.1.18144 WP_000203965.1.18173 WP_000203965.1.18270 WP_000203965.1.18280 WP_000203965.1.18328 WP_000203965.1.18358 WP_000203965.1.18370 WP_000203965.1.18406 WP_000203965.1.18474 WP_000203965.1.18513 WP_000203965.1.18610 WP_000203965.1.18678 WP_000203965.1.18722 WP_000203965.1.18766 WP_000203965.1.1880 WP_000203965.1.1885 WP_000203965.1.18860 WP_000203965.1.18922 WP_000203965.1.18959 WP_000203965.1.19001 WP_000203965.1.19006 WP_000203965.1.19044 WP_000203965.1.19084 WP_000203965.1.19187 WP_000203965.1.19228 WP_000203965.1.19288 WP_000203965.1.19300 WP_000203965.1.19422 WP_000203965.1.19454 WP_000203965.1.19456 WP_000203965.1.19496 WP_000203965.1.19535 WP_000203965.1.19538 WP_000203965.1.19589 WP_000203965.1.19663 WP_000203965.1.19686 WP_000203965.1.19731 WP_000203965.1.19794 WP_000203965.1.1992 WP_000203965.1.19999 WP_000203965.1.20254 WP_000203965.1.20255 WP_000203965.1.20296 WP_000203965.1.20339 WP_000203965.1.20419 WP_000203965.1.20465 WP_000203965.1.20492 WP_000203965.1.2053 WP_000203965.1.20635 WP_000203965.1.20718 WP_000203965.1.2073 WP_000203965.1.20740 WP_000203965.1.20828 WP_000203965.1.2087 WP_000203965.1.20883 WP_000203965.1.20947 WP_000203965.1.20953 WP_000203965.1.21010 WP_000203965.1.2106 WP_000203965.1.21062 WP_000203965.1.21144 WP_000203965.1.21162 WP_000203965.1.21184 WP_000203965.1.21185 WP_000203965.1.21492 WP_000203965.1.2166 WP_000203965.1.21674 WP_000203965.1.21946 WP_000203965.1.21966 WP_000203965.1.22064 WP_000203965.1.22118 WP_000203965.1.22126 WP_000203965.1.2216 WP_000203965.1.22208 WP_000203965.1.2227 WP_000203965.1.22373 WP_000203965.1.22476 WP_000203965.1.22614 WP_000203965.1.22652 WP_000203965.1.22683 WP_000203965.1.2284 WP_000203965.1.22895 WP_000203965.1.22926 WP_000203965.1.22943 WP_000203965.1.22967 WP_000203965.1.23040 WP_000203965.1.23058 WP_000203965.1.23218 WP_000203965.1.2331 WP_000203965.1.2332 WP_000203965.1.23340 WP_000203965.1.2336 WP_000203965.1.23365 WP_000203965.1.23412 WP_000203965.1.23426 WP_000203965.1.23492 WP_000203965.1.23515 WP_000203965.1.23548 WP_000203965.1.23571 WP_000203965.1.23604 WP_000203965.1.23679 WP_000203965.1.23728 WP_000203965.1.2375 WP_000203965.1.23783 WP_000203965.1.23786 WP_000203965.1.23787 WP_000203965.1.23801 WP_000203965.1.24028 WP_000203965.1.24061 WP_000203965.1.24083 WP_000203965.1.24117 WP_000203965.1.24125 WP_000203965.1.24138 WP_000203965.1.24153 WP_000203965.1.24291 WP_000203965.1.24322 WP_000203965.1.24355 WP_000203965.1.24375 WP_000203965.1.24400 WP_000203965.1.24420 WP_000203965.1.24619 WP_000203965.1.24643 WP_000203965.1.24688 WP_000203965.1.24716 WP_000203965.1.2481 WP_000203965.1.24832 WP_000203965.1.24964 WP_000203965.1.25017 WP_000203965.1.25032 WP_000203965.1.25041 WP_000203965.1.25053 WP_000203965.1.25140 WP_000203965.1.25185 WP_000203965.1.25196 WP_000203965.1.25210 WP_000203965.1.25219 WP_000203965.1.25304 WP_000203965.1.25374 WP_000203965.1.25490 WP_000203965.1.25508 WP_000203965.1.25512 WP_000203965.1.25603 WP_000203965.1.2562 WP_000203965.1.25666 WP_000203965.1.25807 WP_000203965.1.25821 WP_000203965.1.25833 WP_000203965.1.25835 WP_000203965.1.25882 WP_000203965.1.25911 WP_000203965.1.25962 WP_000203965.1.25963 WP_000203965.1.26001 WP_000203965.1.26027 WP_000203965.1.26107 WP_000203965.1.2615 WP_000203965.1.26217 WP_000203965.1.26230 WP_000203965.1.26232 WP_000203965.1.26272 WP_000203965.1.26286 WP_000203965.1.26288 WP_000203965.1.26394 WP_000203965.1.26491 WP_000203965.1.2654 WP_000203965.1.26554 WP_000203965.1.26636 WP_000203965.1.26689 WP_000203965.1.2679 WP_000203965.1.26908 WP_000203965.1.2692 WP_000203965.1.26928 WP_000203965.1.270 WP_000203965.1.27008 WP_000203965.1.27027 WP_000203965.1.27070 WP_000203965.1.27077 WP_000203965.1.27086 WP_000203965.1.27087 WP_000203965.1.27111 WP_000203965.1.27115 WP_000203965.1.2713 WP_000203965.1.2717 WP_000203965.1.27228 WP_000203965.1.27282 WP_000203965.1.27285 WP_000203965.1.27309 WP_000203965.1.27329 WP_000203965.1.27361 WP_000203965.1.27565 WP_000203965.1.27595 WP_000203965.1.27598 WP_000203965.1.27706 WP_000203965.1.27775 WP_000203965.1.27785 WP_000203965.1.27900 WP_000203965.1.27928 WP_000203965.1.27945 WP_000203965.1.28004 WP_000203965.1.2809 WP_000203965.1.28155 WP_000203965.1.28198 WP_000203965.1.2822 WP_000203965.1.28229 WP_000203965.1.28384 WP_000203965.1.28386 WP_000203965.1.28395 WP_000203965.1.284 WP_000203965.1.2845 WP_000203965.1.28479 WP_000203965.1.28627 WP_000203965.1.28692 WP_000203965.1.2873 WP_000203965.1.28917 WP_000203965.1.28962 WP_000203965.1.29023 WP_000203965.1.29042 WP_000203965.1.2905 WP_000203965.1.2907 WP_000203965.1.29081 WP_000203965.1.29089 WP_000203965.1.29153 WP_000203965.1.29203 WP_000203965.1.29237 WP_000203965.1.29248 WP_000203965.1.29288 WP_000203965.1.29389 WP_000203965.1.29439 WP_000203965.1.2946 WP_000203965.1.29462 WP_000203965.1.29563 WP_000203965.1.29743 WP_000203965.1.29782 WP_000203965.1.29833 WP_000203965.1.29851 WP_000203965.1.29865 WP_000203965.1.29886 WP_000203965.1.29919 WP_000203965.1.2994 WP_000203965.1.29964 WP_000203965.1.29983 WP_000203965.1.30009 WP_000203965.1.30013 WP_000203965.1.3002 WP_000203965.1.30034 WP_000203965.1.30049 WP_000203965.1.30058 WP_000203965.1.30172 WP_000203965.1.30185 WP_000203965.1.30354 WP_000203965.1.30357 WP_000203965.1.30362 WP_000203965.1.3042 WP_000203965.1.30421 WP_000203965.1.30440 WP_000203965.1.30448 WP_000203965.1.30489 WP_000203965.1.30517 WP_000203965.1.30542 WP_000203965.1.30544 WP_000203965.1.30556 WP_000203965.1.30572 WP_000203965.1.30585 WP_000203965.1.30618 WP_000203965.1.30664 WP_000203965.1.30688 WP_000203965.1.30806 WP_000203965.1.30967 WP_000203965.1.31046 WP_000203965.1.31066 WP_000203965.1.31078 WP_000203965.1.31139 WP_000203965.1.31145 WP_000203965.1.31182 WP_000203965.1.31205 WP_000203965.1.3121 WP_000203965.1.31223 WP_000203965.1.31303 WP_000203965.1.3131 WP_000203965.1.31352 WP_000203965.1.31389 WP_000203965.1.31413 WP_000203965.1.31446 WP_000203965.1.31533 WP_000203965.1.31799 WP_000203965.1.31836 WP_000203965.1.31951 WP_000203965.1.32041 WP_000203965.1.32042 WP_000203965.1.3207 WP_000203965.1.32189 WP_000203965.1.32202 WP_000203965.1.32263 WP_000203965.1.32293 WP_000203965.1.32299 WP_000203965.1.32422 WP_000203965.1.32425 WP_000203965.1.32458 WP_000203965.1.32460 WP_000203965.1.32529 WP_000203965.1.32563 WP_000203965.1.32578 WP_000203965.1.32617 WP_000203965.1.3270 WP_000203965.1.32725 WP_000203965.1.32838 WP_000203965.1.32848 WP_000203965.1.32868 WP_000203965.1.3290 WP_000203965.1.32940 WP_000203965.1.32941 WP_000203965.1.3296 WP_000203965.1.32966 WP_000203965.1.32985 WP_000203965.1.33037 WP_000203965.1.3305 WP_000203965.1.33051 WP_000203965.1.33065 WP_000203965.1.33122 WP_000203965.1.3315 WP_000203965.1.33208 WP_000203965.1.33214 WP_000203965.1.33247 WP_000203965.1.33280 WP_000203965.1.33283 WP_000203965.1.33313 WP_000203965.1.33339 WP_000203965.1.33382 WP_000203965.1.33490 WP_000203965.1.33501 WP_000203965.1.33529 WP_000203965.1.33689 WP_000203965.1.3370 WP_000203965.1.33730 WP_000203965.1.33741 WP_000203965.1.33840 WP_000203965.1.3392 WP_000203965.1.33926 WP_000203965.1.33957 WP_000203965.1.33969 WP_000203965.1.34001 WP_000203965.1.34059 WP_000203965.1.34118 WP_000203965.1.34211 WP_000203965.1.34214 WP_000203965.1.34234 WP_000203965.1.34284 WP_000203965.1.34376 WP_000203965.1.34382 WP_000203965.1.34484 WP_000203965.1.34517 WP_000203965.1.34530 WP_000203965.1.34665 WP_000203965.1.34694 WP_000203965.1.34751 WP_000203965.1.34808 WP_000203965.1.34824 WP_000203965.1.34834 WP_000203965.1.34932 WP_000203965.1.34962 WP_000203965.1.35001 WP_000203965.1.35040 WP_000203965.1.35074 WP_000203965.1.35175 WP_000203965.1.35240 WP_000203965.1.35274 WP_000203965.1.35532 WP_000203965.1.35560 WP_000203965.1.3557 WP_000203965.1.35628 WP_000203965.1.3570 WP_000203965.1.35712 WP_000203965.1.35713 WP_000203965.1.35736 WP_000203965.1.35791 WP_000203965.1.35795 WP_000203965.1.35870 WP_000203965.1.35916 WP_000203965.1.35938 WP_000203965.1.35966 WP_000203965.1.36000 WP_000203965.1.36034 WP_000203965.1.36036 WP_000203965.1.36069 WP_000203965.1.36291 WP_000203965.1.36298 WP_000203965.1.36308 WP_000203965.1.36323 WP_000203965.1.36343 WP_000203965.1.36460 WP_000203965.1.3649 WP_000203965.1.36495 WP_000203965.1.36526 WP_000203965.1.36567 WP_000203965.1.36579 WP_000203965.1.36617 WP_000203965.1.36618 WP_000203965.1.36643 WP_000203965.1.36663 WP_000203965.1.36701 WP_000203965.1.36725 WP_000203965.1.36779 WP_000203965.1.36798 WP_000203965.1.36802 WP_000203965.1.36821 WP_000203965.1.36853 WP_000203965.1.36950 WP_000203965.1.37014 WP_000203965.1.37133 WP_000203965.1.37176 WP_000203965.1.37199 WP_000203965.1.37200 WP_000203965.1.37258 WP_000203965.1.37303 WP_000203965.1.37513 WP_000203965.1.37584 WP_000203965.1.37590 WP_000203965.1.37593 WP_000203965.1.37600 WP_000203965.1.37613 WP_000203965.1.37659 WP_000203965.1.37662 WP_000203965.1.37675 WP_000203965.1.37691 WP_000203965.1.37761 WP_000203965.1.37775 WP_000203965.1.37777 WP_000203965.1.378 WP_000203965.1.379 WP_000203965.1.37911 WP_000203965.1.37941 WP_000203965.1.37985 WP_000203965.1.38061 WP_000203965.1.38064 WP_000203965.1.38108 WP_000203965.1.3816 WP_000203965.1.38207 WP_000203965.1.38261 WP_000203965.1.38266 WP_000203965.1.38310 WP_000203965.1.3834 WP_000203965.1.38351 WP_000203965.1.3838 WP_000203965.1.38381 WP_000203965.1.38440 WP_000203965.1.38486 WP_000203965.1.38515 WP_000203965.1.38595 WP_000203965.1.3860 WP_000203965.1.38734 WP_000203965.1.38877 WP_000203965.1.38983 WP_000203965.1.38996 WP_000203965.1.39056 WP_000203965.1.3907 WP_000203965.1.39105 WP_000203965.1.3914 WP_000203965.1.39147 WP_000203965.1.39161 WP_000203965.1.39210 WP_000203965.1.39235 WP_000203965.1.3931 WP_000203965.1.39435 WP_000203965.1.39502 WP_000203965.1.39530 WP_000203965.1.39619 WP_000203965.1.39620 WP_000203965.1.39624 WP_000203965.1.39659 WP_000203965.1.39667 WP_000203965.1.39775 WP_000203965.1.39879 WP_000203965.1.39890 WP_000203965.1.39941 WP_000203965.1.39945 WP_000203965.1.39947 WP_000203965.1.40095 WP_000203965.1.40097 WP_000203965.1.401 WP_000203965.1.40160 WP_000203965.1.40167 WP_000203965.1.40279 WP_000203965.1.40361 WP_000203965.1.4042 WP_000203965.1.40467 WP_000203965.1.40496 WP_000203965.1.40517 WP_000203965.1.40698 WP_000203965.1.40750 WP_000203965.1.40763 WP_000203965.1.40854 WP_000203965.1.4089 WP_000203965.1.40924 WP_000203965.1.40932 WP_000203965.1.40946 WP_000203965.1.41004 WP_000203965.1.4106 WP_000203965.1.41070 WP_000203965.1.41074 WP_000203965.1.41075 WP_000203965.1.41097 WP_000203965.1.41132 WP_000203965.1.41176 WP_000203965.1.41251 WP_000203965.1.41258 WP_000203965.1.41305 WP_000203965.1.41321 WP_000203965.1.41333 WP_000203965.1.41335 WP_000203965.1.4136 WP_000203965.1.41415 WP_000203965.1.41459 WP_000203965.1.41498 WP_000203965.1.41519 WP_000203965.1.41524 WP_000203965.1.41631 WP_000203965.1.41658 WP_000203965.1.41659 WP_000203965.1.41716 WP_000203965.1.41746 WP_000203965.1.41824 WP_000203965.1.41825 WP_000203965.1.41836 WP_000203965.1.41894 WP_000203965.1.41919 WP_000203965.1.41929 WP_000203965.1.4194 WP_000203965.1.42069 WP_000203965.1.42081 WP_000203965.1.42090 WP_000203965.1.42111 WP_000203965.1.42187 WP_000203965.1.42200 WP_000203965.1.42219 WP_000203965.1.42257 WP_000203965.1.42261 WP_000203965.1.42349 WP_000203965.1.42364 WP_000203965.1.42371 WP_000203965.1.42379 WP_000203965.1.42391 WP_000203965.1.42399 WP_000203965.1.42539 WP_000203965.1.42603 WP_000203965.1.42650 WP_000203965.1.4267 WP_000203965.1.42701 WP_000203965.1.42805 WP_000203965.1.42815 WP_000203965.1.42859 WP_000203965.1.4298 WP_000203965.1.43008 WP_000203965.1.43016 WP_000203965.1.43019 WP_000203965.1.43065 WP_000203965.1.43068 WP_000203965.1.43069 WP_000203965.1.43128 WP_000203965.1.43141 WP_000203965.1.43157 WP_000203965.1.43161 WP_000203965.1.43190 WP_000203965.1.43198 WP_000203965.1.4326 WP_000203965.1.43290 WP_000203965.1.43292 WP_000203965.1.43307 WP_000203965.1.43513 WP_000203965.1.43633 WP_000203965.1.43637 WP_000203965.1.43651 WP_000203965.1.43722 WP_000203965.1.43801 WP_000203965.1.43812 WP_000203965.1.43878 WP_000203965.1.43888 WP_000203965.1.43919 WP_000203965.1.43974 WP_000203965.1.44049 WP_000203965.1.44101 WP_000203965.1.44160 WP_000203965.1.44180 WP_000203965.1.44196 WP_000203965.1.44248 WP_000203965.1.44262 WP_000203965.1.44268 WP_000203965.1.4427 WP_000203965.1.44296 WP_000203965.1.44343 WP_000203965.1.44351 WP_000203965.1.44360 WP_000203965.1.44416 WP_000203965.1.44431 WP_000203965.1.44437 WP_000203965.1.44546 WP_000203965.1.4468 WP_000203965.1.44762 WP_000203965.1.44815 WP_000203965.1.44828 WP_000203965.1.44879 WP_000203965.1.44917 WP_000203965.1.4501 WP_000203965.1.45072 WP_000203965.1.45093 WP_000203965.1.45136 WP_000203965.1.45241 WP_000203965.1.45435 WP_000203965.1.45523 WP_000203965.1.45596 WP_000203965.1.45648 WP_000203965.1.45829 WP_000203965.1.45871 WP_000203965.1.46030 WP_000203965.1.46077 WP_000203965.1.46169 WP_000203965.1.46225 WP_000203965.1.46241 WP_000203965.1.46307 WP_000203965.1.46355 WP_000203965.1.464 WP_000203965.1.46454 WP_000203965.1.46461 WP_000203965.1.46504 WP_000203965.1.46505 WP_000203965.1.46551 WP_000203965.1.46559 WP_000203965.1.46701 WP_000203965.1.46781 WP_000203965.1.46816 WP_000203965.1.46842 WP_000203965.1.4690 WP_000203965.1.46920 WP_000203965.1.46945 WP_000203965.1.47036 WP_000203965.1.47037 WP_000203965.1.47042 WP_000203965.1.47059 WP_000203965.1.47085 WP_000203965.1.47123 WP_000203965.1.47215 WP_000203965.1.47245 WP_000203965.1.47523 WP_000203965.1.47532 WP_000203965.1.47605 WP_000203965.1.47630 WP_000203965.1.4774 WP_000203965.1.47756 WP_000203965.1.4781 WP_000203965.1.47886 WP_000203965.1.47898 WP_000203965.1.48019 WP_000203965.1.48100 WP_000203965.1.48114 WP_000203965.1.48139 WP_000203965.1.48190 WP_000203965.1.48292 WP_000203965.1.48324 WP_000203965.1.48426 WP_000203965.1.48430 WP_000203965.1.48436 WP_000203965.1.48586 WP_000203965.1.4859 WP_000203965.1.48591 WP_000203965.1.48610 WP_000203965.1.48631 WP_000203965.1.48663 WP_000203965.1.48690 WP_000203965.1.48734 WP_000203965.1.48756 WP_000203965.1.48778 WP_000203965.1.48849 WP_000203965.1.48955 WP_000203965.1.48963 WP_000203965.1.48973 WP_000203965.1.49004 WP_000203965.1.49106 WP_000203965.1.49117 WP_000203965.1.49121 WP_000203965.1.4914 WP_000203965.1.49140 WP_000203965.1.49153 WP_000203965.1.49166 WP_000203965.1.49355 WP_000203965.1.49429 WP_000203965.1.49434 WP_000203965.1.49450 WP_000203965.1.495 WP_000203965.1.49545 WP_000203965.1.49703 WP_000203965.1.49769 WP_000203965.1.49846 WP_000203965.1.4991 WP_000203965.1.49947 WP_000203965.1.49959 WP_000203965.1.49997 WP_000203965.1.50014 WP_000203965.1.50030 WP_000203965.1.50043 WP_000203965.1.50103 WP_000203965.1.50158 WP_000203965.1.50247 WP_000203965.1.50308 WP_000203965.1.50309 WP_000203965.1.50387 WP_000203965.1.50406 WP_000203965.1.50468 WP_000203965.1.5051 WP_000203965.1.50566 WP_000203965.1.50570 WP_000203965.1.50626 WP_000203965.1.50726 WP_000203965.1.50771 WP_000203965.1.50875 WP_000203965.1.50885 WP_000203965.1.509 WP_000203965.1.50929 WP_000203965.1.50970 WP_000203965.1.51040 WP_000203965.1.51048 WP_000203965.1.51100 WP_000203965.1.51134 WP_000203965.1.51227 WP_000203965.1.5127 WP_000203965.1.51305 WP_000203965.1.51315 WP_000203965.1.5136 WP_000203965.1.51474 WP_000203965.1.51519 WP_000203965.1.51598 WP_000203965.1.51644 WP_000203965.1.51724 WP_000203965.1.51734 WP_000203965.1.51838 WP_000203965.1.51863 WP_000203965.1.51935 WP_000203965.1.52057 WP_000203965.1.52114 WP_000203965.1.52129 WP_000203965.1.52191 WP_000203965.1.52202 WP_000203965.1.52209 WP_000203965.1.52339 WP_000203965.1.52469 WP_000203965.1.52571 WP_000203965.1.526 WP_000203965.1.52647 WP_000203965.1.52742 WP_000203965.1.52773 WP_000203965.1.52795 WP_000203965.1.52807 WP_000203965.1.52887 WP_000203965.1.53092 WP_000203965.1.53141 WP_000203965.1.53151 WP_000203965.1.53154 WP_000203965.1.53159 WP_000203965.1.53210 WP_000203965.1.53233 WP_000203965.1.53307 WP_000203965.1.53321 WP_000203965.1.53368 WP_000203965.1.53375 WP_000203965.1.53450 WP_000203965.1.5349 WP_000203965.1.53555 WP_000203965.1.53559 WP_000203965.1.5356 WP_000203965.1.53571 WP_000203965.1.5358 WP_000203965.1.53692 WP_000203965.1.53723 WP_000203965.1.5374 WP_000203965.1.53750 WP_000203965.1.53800 WP_000203965.1.53815 WP_000203965.1.53839 WP_000203965.1.53892 WP_000203965.1.53898 WP_000203965.1.53902 WP_000203965.1.53958 WP_000203965.1.53981 WP_000203965.1.53984 WP_000203965.1.54132 WP_000203965.1.54170 WP_000203965.1.54175 WP_000203965.1.54203 WP_000203965.1.54259 WP_000203965.1.5430 WP_000203965.1.54371 WP_000203965.1.54431 WP_000203965.1.54442 WP_000203965.1.54482 WP_000203965.1.54589 WP_000203965.1.54667 WP_000203965.1.54678 WP_000203965.1.54681 WP_000203965.1.54748 WP_000203965.1.5481 WP_000203965.1.54865 WP_000203965.1.54935 WP_000203965.1.54979 WP_000203965.1.55010 WP_000203965.1.55034 WP_000203965.1.55163 WP_000203965.1.55165 WP_000203965.1.55215 WP_000203965.1.55290 WP_000203965.1.55310 WP_000203965.1.55317 WP_000203965.1.55379 WP_000203965.1.5539 WP_000203965.1.55468 WP_000203965.1.55506 WP_000203965.1.55604 WP_000203965.1.55639 WP_000203965.1.55699 WP_000203965.1.55725 WP_000203965.1.55780 WP_000203965.1.55967 WP_000203965.1.56144 WP_000203965.1.56172 WP_000203965.1.5621 WP_000203965.1.56226 WP_000203965.1.56311 WP_000203965.1.56419 WP_000203965.1.56423 WP_000203965.1.56514 WP_000203965.1.56535 WP_000203965.1.56585 WP_000203965.1.56640 WP_000203965.1.56724 WP_000203965.1.56825 WP_000203965.1.56887 WP_000203965.1.56889 WP_000203965.1.56981 WP_000203965.1.57101 WP_000203965.1.57137 WP_000203965.1.57147 WP_000203965.1.57179 WP_000203965.1.57186 WP_000203965.1.57342 WP_000203965.1.57684 WP_000203965.1.57699 WP_000203965.1.57785 WP_000203965.1.57800 WP_000203965.1.57873 WP_000203965.1.57965 WP_000203965.1.57972 WP_000203965.1.58008 WP_000203965.1.58044 WP_000203965.1.58081 WP_000203965.1.5809 WP_000203965.1.58132 WP_000203965.1.58173 WP_000203965.1.58191 WP_000203965.1.58194 WP_000203965.1.58252 WP_000203965.1.58261 WP_000203965.1.58274 WP_000203965.1.58282 WP_000203965.1.58324 WP_000203965.1.58326 WP_000203965.1.5836 WP_000203965.1.58485 WP_000203965.1.58537 WP_000203965.1.58568 WP_000203965.1.58583 WP_000203965.1.58652 WP_000203965.1.58663 WP_000203965.1.58724 WP_000203965.1.5875 WP_000203965.1.58796 WP_000203965.1.58807 WP_000203965.1.58847 WP_000203965.1.58883 WP_000203965.1.58898 WP_000203965.1.58949 WP_000203965.1.58963 WP_000203965.1.58970 WP_000203965.1.58974 WP_000203965.1.59020 WP_000203965.1.59043 WP_000203965.1.59056 WP_000203965.1.59061 WP_000203965.1.59064 WP_000203965.1.59282 WP_000203965.1.59299 WP_000203965.1.59313 WP_000203965.1.5949 WP_000203965.1.59501 WP_000203965.1.59510 WP_000203965.1.5969 WP_000203965.1.59751 WP_000203965.1.59827 WP_000203965.1.59829 WP_000203965.1.59847 WP_000203965.1.59863 WP_000203965.1.59969 WP_000203965.1.59994 WP_000203965.1.60045 WP_000203965.1.60076 WP_000203965.1.60114 WP_000203965.1.60154 WP_000203965.1.60168 WP_000203965.1.60192 WP_000203965.1.60199 WP_000203965.1.60212 WP_000203965.1.60253 WP_000203965.1.60322 WP_000203965.1.60324 WP_000203965.1.60356 WP_000203965.1.6038 WP_000203965.1.60380 WP_000203965.1.6041 WP_000203965.1.60424 WP_000203965.1.60481 WP_000203965.1.605 WP_000203965.1.6058 WP_000203965.1.60584 WP_000203965.1.6060 WP_000203965.1.60676 WP_000203965.1.60708 WP_000203965.1.60725 WP_000203965.1.60783 WP_000203965.1.60792 WP_000203965.1.60807 WP_000203965.1.60882 WP_000203965.1.60889 WP_000203965.1.60950 WP_000203965.1.6104 WP_000203965.1.61044 WP_000203965.1.61076 WP_000203965.1.61123 WP_000203965.1.61147 WP_000203965.1.61168 WP_000203965.1.61210 WP_000203965.1.61357 WP_000203965.1.61511 WP_000203965.1.61539 WP_000203965.1.61542 WP_000203965.1.61553 WP_000203965.1.61649 WP_000203965.1.61652 WP_000203965.1.61697 WP_000203965.1.61809 WP_000203965.1.61877 WP_000203965.1.61920 WP_000203965.1.62124 WP_000203965.1.62199 WP_000203965.1.62223 WP_000203965.1.62302 WP_000203965.1.62314 WP_000203965.1.62323 WP_000203965.1.62333 WP_000203965.1.62338 WP_000203965.1.62380 WP_000203965.1.62411 WP_000203965.1.62436 WP_000203965.1.62475 WP_000203965.1.62536 WP_000203965.1.62640 WP_000203965.1.62686 WP_000203965.1.62751 WP_000203965.1.62825 WP_000203965.1.62913 WP_000203965.1.62932 WP_000203965.1.62960 WP_000203965.1.63016 WP_000203965.1.63025 WP_000203965.1.63069 WP_000203965.1.63087 WP_000203965.1.63169 WP_000203965.1.63297 WP_000203965.1.63448 WP_000203965.1.63514 WP_000203965.1.63583 WP_000203965.1.63592 WP_000203965.1.63663 WP_000203965.1.63736 WP_000203965.1.63816 WP_000203965.1.63876 WP_000203965.1.6389 WP_000203965.1.63901 WP_000203965.1.63955 WP_000203965.1.63963 WP_000203965.1.64032 WP_000203965.1.64087 WP_000203965.1.6415 WP_000203965.1.64293 WP_000203965.1.64332 WP_000203965.1.64376 WP_000203965.1.644 WP_000203965.1.64471 WP_000203965.1.64501 WP_000203965.1.64538 WP_000203965.1.64632 WP_000203965.1.64648 WP_000203965.1.64654 WP_000203965.1.64662 WP_000203965.1.64663 WP_000203965.1.64709 WP_000203965.1.64710 WP_000203965.1.64744 WP_000203965.1.64763 WP_000203965.1.64817 WP_000203965.1.64847 WP_000203965.1.6487 WP_000203965.1.64891 WP_000203965.1.64974 WP_000203965.1.65054 WP_000203965.1.65075 WP_000203965.1.65172 WP_000203965.1.65191 WP_000203965.1.65200 WP_000203965.1.65211 WP_000203965.1.65218 WP_000203965.1.65226 WP_000203965.1.65249 WP_000203965.1.65266 WP_000203965.1.65395 WP_000203965.1.65459 WP_000203965.1.65463 WP_000203965.1.65487 WP_000203965.1.6549 WP_000203965.1.65499 WP_000203965.1.6554 WP_000203965.1.65650 WP_000203965.1.65697 WP_000203965.1.65699 WP_000203965.1.65737 WP_000203965.1.65755 WP_000203965.1.65812 WP_000203965.1.65846 WP_000203965.1.65863 WP_000203965.1.65985 WP_000203965.1.66021 WP_000203965.1.66031 WP_000203965.1.66052 WP_000203965.1.66064 WP_000203965.1.66109 WP_000203965.1.66145 WP_000203965.1.66183 WP_000203965.1.6620 WP_000203965.1.66216 WP_000203965.1.66234 WP_000203965.1.66273 WP_000203965.1.66324 WP_000203965.1.6634 WP_000203965.1.66361 WP_000203965.1.66480 WP_000203965.1.66506 WP_000203965.1.66665 WP_000203965.1.66681 WP_000203965.1.66684 WP_000203965.1.66755 WP_000203965.1.66759 WP_000203965.1.66801 WP_000203965.1.66860 WP_000203965.1.66953 WP_000203965.1.66955 WP_000203965.1.66981 WP_000203965.1.67024 WP_000203965.1.67042 WP_000203965.1.67101 WP_000203965.1.67143 WP_000203965.1.67201 WP_000203965.1.67211 WP_000203965.1.67237 WP_000203965.1.67336 WP_000203965.1.67339 WP_000203965.1.67387 WP_000203965.1.67394 WP_000203965.1.67397 WP_000203965.1.67403 WP_000203965.1.67430 WP_000203965.1.67442 WP_000203965.1.67539 WP_000203965.1.67556 WP_000203965.1.67576 WP_000203965.1.67604 WP_000203965.1.67619 WP_000203965.1.67625 WP_000203965.1.67627 WP_000203965.1.67641 WP_000203965.1.67657 WP_000203965.1.67673 WP_000203965.1.67700 WP_000203965.1.67718 WP_000203965.1.67729 WP_000203965.1.67774 WP_000203965.1.67820 WP_000203965.1.67910 WP_000203965.1.67954 WP_000203965.1.68 WP_000203965.1.68043 WP_000203965.1.68105 WP_000203965.1.68113 WP_000203965.1.68131 WP_000203965.1.68182 WP_000203965.1.6819 WP_000203965.1.68285 WP_000203965.1.68359 WP_000203965.1.68420 WP_000203965.1.68514 WP_000203965.1.68564 WP_000203965.1.68688 WP_000203965.1.68742 WP_000203965.1.68770 WP_000203965.1.68809 WP_000203965.1.68914 WP_000203965.1.69053 WP_000203965.1.69170 WP_000203965.1.69210 WP_000203965.1.69270 WP_000203965.1.69282 WP_000203965.1.69376 WP_000203965.1.69396 WP_000203965.1.69466 WP_000203965.1.69611 WP_000203965.1.69642 WP_000203965.1.69656 WP_000203965.1.69657 WP_000203965.1.69690 WP_000203965.1.69923 WP_000203965.1.69948 WP_000203965.1.69953 WP_000203965.1.70010 WP_000203965.1.70049 WP_000203965.1.70058 WP_000203965.1.70061 WP_000203965.1.70205 WP_000203965.1.70240 WP_000203965.1.70249 WP_000203965.1.70261 WP_000203965.1.70314 WP_000203965.1.7033 WP_000203965.1.70427 WP_000203965.1.70433 WP_000203965.1.70545 WP_000203965.1.70623 WP_000203965.1.70671 WP_000203965.1.70679 WP_000203965.1.70708 WP_000203965.1.70717 WP_000203965.1.70731 WP_000203965.1.70772 WP_000203965.1.70845 WP_000203965.1.70846 WP_000203965.1.70981 WP_000203965.1.70995 WP_000203965.1.71039 WP_000203965.1.71057 WP_000203965.1.71081 WP_000203965.1.71117 WP_000203965.1.71186 WP_000203965.1.71455 WP_000203965.1.71456 WP_000203965.1.71487 WP_000203965.1.71523 WP_000203965.1.71542 WP_000203965.1.71566 WP_000203965.1.71640 WP_000203965.1.71651 WP_000203965.1.71653 WP_000203965.1.71716 WP_000203965.1.71872 WP_000203965.1.71950 WP_000203965.1.71954 WP_000203965.1.71985 WP_000203965.1.72003 WP_000203965.1.72073 WP_000203965.1.72269 WP_000203965.1.72350 WP_000203965.1.72383 WP_000203965.1.72461 WP_000203965.1.72527 WP_000203965.1.7255 WP_000203965.1.72631 WP_000203965.1.72638 WP_000203965.1.72667 WP_000203965.1.72674 WP_000203965.1.72724 WP_000203965.1.72789 WP_000203965.1.72828 WP_000203965.1.72896 WP_000203965.1.72969 WP_000203965.1.72987 WP_000203965.1.73052 WP_000203965.1.7311 WP_000203965.1.73114 WP_000203965.1.73177 WP_000203965.1.73180 WP_000203965.1.73258 WP_000203965.1.73285 WP_000203965.1.7332 WP_000203965.1.7333 WP_000203965.1.73352 WP_000203965.1.73389 WP_000203965.1.73425 WP_000203965.1.73488 WP_000203965.1.73504 WP_000203965.1.7353 WP_000203965.1.73544 WP_000203965.1.73598 WP_000203965.1.7361 WP_000203965.1.73648 WP_000203965.1.73768 WP_000203965.1.73849 WP_000203965.1.73948 WP_000203965.1.73999 WP_000203965.1.74024 WP_000203965.1.74030 WP_000203965.1.74038 WP_000203965.1.74043 WP_000203965.1.74058 WP_000203965.1.74070 WP_000203965.1.74077 WP_000203965.1.74135 WP_000203965.1.74214 WP_000203965.1.74241 WP_000203965.1.74285 WP_000203965.1.7430 WP_000203965.1.74317 WP_000203965.1.74415 WP_000203965.1.74616 WP_000203965.1.74621 WP_000203965.1.74647 WP_000203965.1.74677 WP_000203965.1.74699 WP_000203965.1.74831 WP_000203965.1.74894 WP_000203965.1.74929 WP_000203965.1.74939 WP_000203965.1.74973 WP_000203965.1.7507 WP_000203965.1.75089 WP_000203965.1.75116 WP_000203965.1.75237 WP_000203965.1.75273 WP_000203965.1.75296 WP_000203965.1.75413 WP_000203965.1.75433 WP_000203965.1.75532 WP_000203965.1.75565 WP_000203965.1.75593 WP_000203965.1.75610 WP_000203965.1.75633 WP_000203965.1.75718 WP_000203965.1.75745 WP_000203965.1.75844 WP_000203965.1.75886 WP_000203965.1.75898 WP_000203965.1.76081 WP_000203965.1.76116 WP_000203965.1.76122 WP_000203965.1.76256 WP_000203965.1.76339 WP_000203965.1.76366 WP_000203965.1.76417 WP_000203965.1.7646 WP_000203965.1.76510 WP_000203965.1.76558 WP_000203965.1.76572 WP_000203965.1.76641 WP_000203965.1.76651 WP_000203965.1.76653 WP_000203965.1.76788 WP_000203965.1.76854 WP_000203965.1.76916 WP_000203965.1.76932 WP_000203965.1.76973 WP_000203965.1.76988 WP_000203965.1.77016 WP_000203965.1.77087 WP_000203965.1.77090 WP_000203965.1.77111 WP_000203965.1.77299 WP_000203965.1.77384 WP_000203965.1.77501 WP_000203965.1.77512 WP_000203965.1.77513 WP_000203965.1.77563 WP_000203965.1.77702 WP_000203965.1.77713 WP_000203965.1.7772 WP_000203965.1.77825 WP_000203965.1.77837 WP_000203965.1.77900 WP_000203965.1.77923 WP_000203965.1.77975 WP_000203965.1.78035 WP_000203965.1.78048 WP_000203965.1.78107 WP_000203965.1.78166 WP_000203965.1.78192 WP_000203965.1.78195 WP_000203965.1.78291 WP_000203965.1.78309 WP_000203965.1.78320 WP_000203965.1.78382 WP_000203965.1.78388 WP_000203965.1.78410 WP_000203965.1.7862 WP_000203965.1.78626 WP_000203965.1.78661 WP_000203965.1.78674 WP_000203965.1.78676 WP_000203965.1.78761 WP_000203965.1.789 WP_000203965.1.78993 WP_000203965.1.79012 WP_000203965.1.79069 WP_000203965.1.79074 WP_000203965.1.79098 WP_000203965.1.79155 WP_000203965.1.79164 WP_000203965.1.79204 WP_000203965.1.79280 WP_000203965.1.79397 WP_000203965.1.79456 WP_000203965.1.79532 WP_000203965.1.79547 WP_000203965.1.79654 WP_000203965.1.7970 WP_000203965.1.79722 WP_000203965.1.79772 WP_000203965.1.79880 WP_000203965.1.79916 WP_000203965.1.80065 WP_000203965.1.80103 WP_000203965.1.80273 WP_000203965.1.80282 WP_000203965.1.80354 WP_000203965.1.80368 WP_000203965.1.80386 WP_000203965.1.80400 WP_000203965.1.80462 WP_000203965.1.8049 WP_000203965.1.80492 WP_000203965.1.80569 WP_000203965.1.80664 WP_000203965.1.80696 WP_000203965.1.80984 WP_000203965.1.81131 WP_000203965.1.81187 WP_000203965.1.81262 WP_000203965.1.81268 WP_000203965.1.81269 WP_000203965.1.81271 WP_000203965.1.8131 WP_000203965.1.81333 WP_000203965.1.81342 WP_000203965.1.81364 WP_000203965.1.81494 WP_000203965.1.81557 WP_000203965.1.81676 WP_000203965.1.81681 WP_000203965.1.8170 WP_000203965.1.81763 WP_000203965.1.81855 WP_000203965.1.81921 WP_000203965.1.81931 WP_000203965.1.81936 WP_000203965.1.81949 WP_000203965.1.82070 WP_000203965.1.82076 WP_000203965.1.82131 WP_000203965.1.82156 WP_000203965.1.8218 WP_000203965.1.82180 WP_000203965.1.82201 WP_000203965.1.82214 WP_000203965.1.82225 WP_000203965.1.8240 WP_000203965.1.82408 WP_000203965.1.82416 WP_000203965.1.8242 WP_000203965.1.82456 WP_000203965.1.82465 WP_000203965.1.82473 WP_000203965.1.82553 WP_000203965.1.82646 WP_000203965.1.82670 WP_000203965.1.82731 WP_000203965.1.82812 WP_000203965.1.82850 WP_000203965.1.82872 WP_000203965.1.8294 WP_000203965.1.82959 WP_000203965.1.83007 WP_000203965.1.8304 WP_000203965.1.83180 WP_000203965.1.83229 WP_000203965.1.83235 WP_000203965.1.83290 WP_000203965.1.83333 WP_000203965.1.83657 WP_000203965.1.83677 WP_000203965.1.8375 WP_000203965.1.83923 WP_000203965.1.83994 WP_000203965.1.84 WP_000203965.1.8406 WP_000203965.1.84076 WP_000203965.1.84127 WP_000203965.1.84150 WP_000203965.1.84230 WP_000203965.1.84252 WP_000203965.1.8431 WP_000203965.1.84345 WP_000203965.1.84369 WP_000203965.1.84401 WP_000203965.1.84435 WP_000203965.1.84567 WP_000203965.1.84631 WP_000203965.1.84727 WP_000203965.1.84744 WP_000203965.1.84773 WP_000203965.1.84945 WP_000203965.1.84967 WP_000203965.1.85004 WP_000203965.1.8502 WP_000203965.1.85039 WP_000203965.1.85153 WP_000203965.1.85273 WP_000203965.1.85338 WP_000203965.1.85339 WP_000203965.1.85511 WP_000203965.1.85512 WP_000203965.1.8557 WP_000203965.1.85606 WP_000203965.1.85635 WP_000203965.1.85646 WP_000203965.1.85665 WP_000203965.1.85669 WP_000203965.1.85688 WP_000203965.1.85703 WP_000203965.1.85728 WP_000203965.1.85746 WP_000203965.1.85811 WP_000203965.1.859 WP_000203965.1.85917 WP_000203965.1.8594 WP_000203965.1.85977 WP_000203965.1.860 WP_000203965.1.8605 WP_000203965.1.86084 WP_000203965.1.8610 WP_000203965.1.8614 WP_000203965.1.86156 WP_000203965.1.86323 WP_000203965.1.86342 WP_000203965.1.8640 WP_000203965.1.8642 WP_000203965.1.86426 WP_000203965.1.86489 WP_000203965.1.86530 WP_000203965.1.86663 WP_000203965.1.86770 WP_000203965.1.86794 WP_000203965.1.86800 WP_000203965.1.86811 WP_000203965.1.86815 WP_000203965.1.86945 WP_000203965.1.86989 WP_000203965.1.87023 WP_000203965.1.87034 WP_000203965.1.87041 WP_000203965.1.87136 WP_000203965.1.87155 WP_000203965.1.87258 WP_000203965.1.87293 WP_000203965.1.87420 WP_000203965.1.87528 WP_000203965.1.87560 WP_000203965.1.8760 WP_000203965.1.87600 WP_000203965.1.87609 WP_000203965.1.87612 WP_000203965.1.87615 WP_000203965.1.87653 WP_000203965.1.87659 WP_000203965.1.87698 WP_000203965.1.87706 WP_000203965.1.87739 WP_000203965.1.87741 WP_000203965.1.87742 WP_000203965.1.87852 WP_000203965.1.87949 WP_000203965.1.88025 WP_000203965.1.88026 WP_000203965.1.8805 WP_000203965.1.8806 WP_000203965.1.881 WP_000203965.1.88145 WP_000203965.1.88199 WP_000203965.1.88299 WP_000203965.1.88313 WP_000203965.1.88359 WP_000203965.1.88407 WP_000203965.1.88414 WP_000203965.1.88444 WP_000203965.1.88446 WP_000203965.1.88458 WP_000203965.1.88501 WP_000203965.1.88538 WP_000203965.1.88547 WP_000203965.1.886 WP_000203965.1.88647 WP_000203965.1.88648 WP_000203965.1.88692 WP_000203965.1.88707 WP_000203965.1.88727 WP_000203965.1.88772 WP_000203965.1.88850 WP_000203965.1.8889 WP_000203965.1.88892 WP_000203965.1.88894 WP_000203965.1.89182 WP_000203965.1.89298 WP_000203965.1.89308 WP_000203965.1.89314 WP_000203965.1.89328 WP_000203965.1.89332 WP_000203965.1.89343 WP_000203965.1.89395 WP_000203965.1.8940 WP_000203965.1.89449 WP_000203965.1.8947 WP_000203965.1.89503 WP_000203965.1.89591 WP_000203965.1.89668 WP_000203965.1.89706 WP_000203965.1.89713 WP_000203965.1.89733 WP_000203965.1.89796 WP_000203965.1.89804 WP_000203965.1.89845 WP_000203965.1.89888 WP_000203965.1.89911 WP_000203965.1.8995 WP_000203965.1.89952 WP_000203965.1.90007 WP_000203965.1.9011 WP_000203965.1.90196 WP_000203965.1.90240 WP_000203965.1.90274 WP_000203965.1.90280 WP_000203965.1.90330 WP_000203965.1.90338 WP_000203965.1.90365 WP_000203965.1.90428 WP_000203965.1.90489 WP_000203965.1.90513 WP_000203965.1.90582 WP_000203965.1.90713 WP_000203965.1.90794 WP_000203965.1.90796 WP_000203965.1.90811 WP_000203965.1.9091 WP_000203965.1.91067 WP_000203965.1.91164 WP_000203965.1.91205 WP_000203965.1.91239 WP_000203965.1.91291 WP_000203965.1.91313 WP_000203965.1.9135 WP_000203965.1.91506 WP_000203965.1.91557 WP_000203965.1.91597 WP_000203965.1.91715 WP_000203965.1.9187 WP_000203965.1.91870 WP_000203965.1.92018 WP_000203965.1.92087 WP_000203965.1.92098 WP_000203965.1.92156 WP_000203965.1.92172 WP_000203965.1.92240 WP_000203965.1.92243 WP_000203965.1.92327 WP_000203965.1.92470 WP_000203965.1.92477 WP_000203965.1.92545 WP_000203965.1.92570 WP_000203965.1.92588 WP_000203965.1.926 WP_000203965.1.92633 WP_000203965.1.92649 WP_000203965.1.92676 WP_000203965.1.92705 WP_000203965.1.9271 WP_000203965.1.92734 WP_000203965.1.92810 WP_000203965.1.92823 WP_000203965.1.92987 WP_000203965.1.93007 WP_000203965.1.93022 WP_000203965.1.93103 WP_000203965.1.93105 WP_000203965.1.93111 WP_000203965.1.93121 WP_000203965.1.93168 WP_000203965.1.93184 WP_000203965.1.93221 WP_000203965.1.93223 WP_000203965.1.93239 WP_000203965.1.93302 WP_000203965.1.9336 WP_000203965.1.93387 WP_000203965.1.93469 WP_000203965.1.93511 WP_000203965.1.93512 WP_000203965.1.93635 WP_000203965.1.93657 WP_000203965.1.9374 WP_000203965.1.9375 WP_000203965.1.93754 WP_000203965.1.93780 WP_000203965.1.93828 WP_000203965.1.93842 WP_000203965.1.93843 WP_000203965.1.93875 WP_000203965.1.93909 WP_000203965.1.93919 WP_000203965.1.93938 WP_000203965.1.93984 WP_000203965.1.9399 WP_000203965.1.94017 WP_000203965.1.94079 WP_000203965.1.94097 WP_000203965.1.94107 WP_000203965.1.94142 WP_000203965.1.94215 WP_000203965.1.94303 WP_000203965.1.94365 WP_000203965.1.94390 WP_000203965.1.94415 WP_000203965.1.94492 WP_000203965.1.94510 WP_000203965.1.94527 WP_000203965.1.94573 WP_000203965.1.94579 WP_000203965.1.94586 WP_000203965.1.94593 WP_000203965.1.94650 WP_000203965.1.94659 WP_000203965.1.94662 WP_000203965.1.94700 WP_000203965.1.94745 WP_000203965.1.94782 WP_000203965.1.94815 WP_000203965.1.94820 WP_000203965.1.94850 WP_000203965.1.94851 WP_000203965.1.94864 WP_000203965.1.94952 WP_000203965.1.95006 WP_000203965.1.95055 WP_000203965.1.95076 WP_000203965.1.95099 WP_000203965.1.95165 WP_000203965.1.95239 WP_000203965.1.95246 WP_000203965.1.9525 WP_000203965.1.95255 WP_000203965.1.95265 WP_000203965.1.95338 WP_000203965.1.95412 WP_000203965.1.95530 WP_000203965.1.95547 WP_000203965.1.95590 WP_000203965.1.95625 WP_000203965.1.95675 WP_000203965.1.95716 WP_000203965.1.95776 WP_000203965.1.95884 WP_000203965.1.95890 WP_000203965.1.95906 WP_000203965.1.96025 WP_000203965.1.96044 WP_000203965.1.96054 WP_000203965.1.96094 WP_000203965.1.96127 WP_000203965.1.96144 WP_000203965.1.96188 WP_000203965.1.96211 WP_000203965.1.96212 WP_000203965.1.96319 WP_000203965.1.9633 WP_000203965.1.96359 WP_000203965.1.96539 WP_000203965.1.96552 WP_000203965.1.96610 WP_000203965.1.96625 WP_000203965.1.96635 WP_000203965.1.9664 WP_000203965.1.96675 WP_000203965.1.9670 WP_000203965.1.96750 WP_000203965.1.96792 WP_000203965.1.96801 WP_000203965.1.96803 WP_000203965.1.96925 WP_000203965.1.96938 WP_000203965.1.96946 WP_000203965.1.96957 WP_000203965.1.96978 WP_000203965.1.97026 WP_000203965.1.97028 WP_000203965.1.97079 WP_000203965.1.97154 WP_000203965.1.97184 WP_000203965.1.97287 WP_000203965.1.97291 WP_000203965.1.97422 WP_000203965.1.97441 WP_000203965.1.97497 WP_000203965.1.97505 WP_000203965.1.97599 WP_000203965.1.97606 WP_000203965.1.97615 WP_000203965.1.97646 WP_000203965.1.97690 WP_000203965.1.97819 WP_000203965.1.97840 WP_000203965.1.97938 WP_000203965.1.97986 WP_000203965.1.98036 WP_000203965.1.98080 WP_000203965.1.98086 WP_000203965.1.98158 WP_000203965.1.98263 WP_000203965.1.98418 WP_000203965.1.98448 WP_000203965.1.98457 WP_000203965.1.9850 WP_000203965.1.98502 WP_000203965.1.98607 WP_000203965.1.98731 WP_000203965.1.98762 WP_000203965.1.9877 WP_000203965.1.98801 WP_000203965.1.98818 WP_000203965.1.99163 WP_000203965.1.99335 WP_000203965.1.99350 WP_000203965.1.99360 WP_000203965.1.99363 WP_000203965.1.99369 WP_000203965.1.99388 WP_000203965.1.99397 WP_000203965.1.99463 WP_000203965.1.99483 WP_000203965.1.99546 WP_000203965.1.99579 WP_000203965.1.99595 WP_000203965.1.99671 WP_000203965.1.99676 WP_000203965.1.99764 WP_000203965.1.99829 WP_000203965.1.99837 WP_000203965.1.99841 WP_000203965.1.9992 WP_000203965.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]