SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759562|ref|NP_455179.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759562|ref|NP_455179.1|
Domain Number 1 Region: 10-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.13e-99
Family AAT-like 0.0000000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16759562|ref|NP_455179.1|
Sequence length 386
Comment aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MRNNPLIPKSKLPNLGTTIFTQMSALAQKHQAINLSQGFPDFDGPSYLHERLAYHVAQGA
NQYAPMTGAQALREAIADKTAEIYGYRPDDVSDITVTAGATEALYAAITALVRAGDEVIC
FDPSYDSYAPAVALSGGVLKRIALTPPHFRVDWQAFSALLSERTRLVILNTPHNPTATVW
RQADIEALWQAIGEREIYVLSDEVYEHICFAAEGHASVLAHPQLRERAVAVSSFGKTFHM
TGWKIGYCVAPAAISAEIRKVHQYLTFCVNTPAQLALADMLRAAPEHYRALPDFYRKKRD
VLVNALAQSRLKVLPCEGTYFLLIDYSAVSTLNDVEFCQWLTEEVGVAAIPLSVFCAAPF
PHQLIRLCFAKQESTLLAAAERLCKL
Download sequence
Identical sequences A0A100PQY8 A0A271CQK5 A0A2K2YUH4 G5L604 Q8Z8K5
gi|16759562|ref|NP_455179.1| AE014613|CDS_2332092-2330932 AL513382|CDS_649009-650169 gi|29142665|ref|NP_806007.1| gi|378960437|ref|YP_005217923.1| NP_455179.1.84458 WP_001245604.1.100008 WP_001245604.1.100036 WP_001245604.1.100079 WP_001245604.1.100196 WP_001245604.1.100284 WP_001245604.1.100313 WP_001245604.1.100314 WP_001245604.1.100321 WP_001245604.1.100354 WP_001245604.1.100421 WP_001245604.1.100432 WP_001245604.1.100446 WP_001245604.1.100450 WP_001245604.1.100592 WP_001245604.1.100610 WP_001245604.1.10065 WP_001245604.1.100732 WP_001245604.1.100733 WP_001245604.1.100739 WP_001245604.1.100764 WP_001245604.1.100799 WP_001245604.1.100941 WP_001245604.1.100953 WP_001245604.1.101011 WP_001245604.1.10108 WP_001245604.1.101223 WP_001245604.1.101226 WP_001245604.1.10124 WP_001245604.1.101271 WP_001245604.1.101312 WP_001245604.1.101322 WP_001245604.1.101374 WP_001245604.1.101609 WP_001245604.1.101616 WP_001245604.1.101740 WP_001245604.1.101744 WP_001245604.1.101890 WP_001245604.1.101941 WP_001245604.1.102050 WP_001245604.1.102087 WP_001245604.1.10276 WP_001245604.1.10338 WP_001245604.1.1038 WP_001245604.1.104 WP_001245604.1.10401 WP_001245604.1.10428 WP_001245604.1.10459 WP_001245604.1.10475 WP_001245604.1.10511 WP_001245604.1.10514 WP_001245604.1.10530 WP_001245604.1.10532 WP_001245604.1.10547 WP_001245604.1.10595 WP_001245604.1.10642 WP_001245604.1.10654 WP_001245604.1.10677 WP_001245604.1.10857 WP_001245604.1.10873 WP_001245604.1.10926 WP_001245604.1.10936 WP_001245604.1.11012 WP_001245604.1.11055 WP_001245604.1.11126 WP_001245604.1.11142 WP_001245604.1.11239 WP_001245604.1.11253 WP_001245604.1.11314 WP_001245604.1.1135 WP_001245604.1.11385 WP_001245604.1.1142 WP_001245604.1.11426 WP_001245604.1.11429 WP_001245604.1.11557 WP_001245604.1.11567 WP_001245604.1.11638 WP_001245604.1.11883 WP_001245604.1.11908 WP_001245604.1.11914 WP_001245604.1.11938 WP_001245604.1.12061 WP_001245604.1.1207 WP_001245604.1.12141 WP_001245604.1.12172 WP_001245604.1.12192 WP_001245604.1.1224 WP_001245604.1.12364 WP_001245604.1.12398 WP_001245604.1.12441 WP_001245604.1.1250 WP_001245604.1.12581 WP_001245604.1.12620 WP_001245604.1.12648 WP_001245604.1.12683 WP_001245604.1.12726 WP_001245604.1.12741 WP_001245604.1.12834 WP_001245604.1.12864 WP_001245604.1.13108 WP_001245604.1.13161 WP_001245604.1.1321 WP_001245604.1.13268 WP_001245604.1.13291 WP_001245604.1.133 WP_001245604.1.13314 WP_001245604.1.13338 WP_001245604.1.13342 WP_001245604.1.13352 WP_001245604.1.13406 WP_001245604.1.13440 WP_001245604.1.13443 WP_001245604.1.13476 WP_001245604.1.13543 WP_001245604.1.13599 WP_001245604.1.1372 WP_001245604.1.13732 WP_001245604.1.13750 WP_001245604.1.1382 WP_001245604.1.13848 WP_001245604.1.1397 WP_001245604.1.13972 WP_001245604.1.1408 WP_001245604.1.14089 WP_001245604.1.14099 WP_001245604.1.14120 WP_001245604.1.14150 WP_001245604.1.14191 WP_001245604.1.14197 WP_001245604.1.14333 WP_001245604.1.14399 WP_001245604.1.14444 WP_001245604.1.14467 WP_001245604.1.14474 WP_001245604.1.14500 WP_001245604.1.14526 WP_001245604.1.14550 WP_001245604.1.14575 WP_001245604.1.14701 WP_001245604.1.14703 WP_001245604.1.14719 WP_001245604.1.14765 WP_001245604.1.14810 WP_001245604.1.14877 WP_001245604.1.14884 WP_001245604.1.14894 WP_001245604.1.14917 WP_001245604.1.14930 WP_001245604.1.14947 WP_001245604.1.14948 WP_001245604.1.15059 WP_001245604.1.15184 WP_001245604.1.15244 WP_001245604.1.15265 WP_001245604.1.15362 WP_001245604.1.15415 WP_001245604.1.15423 WP_001245604.1.15433 WP_001245604.1.15439 WP_001245604.1.15487 WP_001245604.1.15535 WP_001245604.1.15581 WP_001245604.1.15597 WP_001245604.1.15710 WP_001245604.1.15717 WP_001245604.1.15835 WP_001245604.1.15905 WP_001245604.1.15912 WP_001245604.1.15970 WP_001245604.1.16046 WP_001245604.1.16051 WP_001245604.1.16058 WP_001245604.1.16150 WP_001245604.1.16155 WP_001245604.1.1626 WP_001245604.1.16264 WP_001245604.1.16344 WP_001245604.1.16452 WP_001245604.1.16461 WP_001245604.1.16462 WP_001245604.1.16465 WP_001245604.1.16508 WP_001245604.1.16522 WP_001245604.1.16588 WP_001245604.1.16658 WP_001245604.1.16666 WP_001245604.1.16673 WP_001245604.1.1674 WP_001245604.1.16767 WP_001245604.1.16781 WP_001245604.1.16879 WP_001245604.1.16893 WP_001245604.1.16910 WP_001245604.1.16948 WP_001245604.1.17049 WP_001245604.1.17058 WP_001245604.1.17078 WP_001245604.1.17202 WP_001245604.1.17219 WP_001245604.1.1722 WP_001245604.1.17302 WP_001245604.1.17308 WP_001245604.1.17368 WP_001245604.1.17405 WP_001245604.1.17406 WP_001245604.1.17504 WP_001245604.1.17513 WP_001245604.1.17543 WP_001245604.1.17563 WP_001245604.1.17578 WP_001245604.1.17622 WP_001245604.1.17659 WP_001245604.1.17667 WP_001245604.1.17686 WP_001245604.1.17741 WP_001245604.1.17840 WP_001245604.1.17956 WP_001245604.1.18005 WP_001245604.1.1801 WP_001245604.1.18021 WP_001245604.1.18099 WP_001245604.1.18124 WP_001245604.1.18144 WP_001245604.1.18173 WP_001245604.1.18270 WP_001245604.1.18280 WP_001245604.1.18328 WP_001245604.1.18358 WP_001245604.1.18370 WP_001245604.1.18406 WP_001245604.1.18474 WP_001245604.1.18513 WP_001245604.1.18610 WP_001245604.1.18678 WP_001245604.1.18722 WP_001245604.1.18766 WP_001245604.1.1885 WP_001245604.1.18860 WP_001245604.1.18922 WP_001245604.1.18959 WP_001245604.1.19001 WP_001245604.1.19006 WP_001245604.1.19044 WP_001245604.1.19187 WP_001245604.1.19228 WP_001245604.1.19288 WP_001245604.1.19300 WP_001245604.1.19422 WP_001245604.1.19454 WP_001245604.1.19456 WP_001245604.1.19496 WP_001245604.1.19535 WP_001245604.1.19538 WP_001245604.1.19589 WP_001245604.1.19663 WP_001245604.1.19686 WP_001245604.1.19731 WP_001245604.1.19794 WP_001245604.1.1992 WP_001245604.1.19999 WP_001245604.1.20218 WP_001245604.1.20254 WP_001245604.1.20255 WP_001245604.1.20296 WP_001245604.1.20339 WP_001245604.1.2036 WP_001245604.1.20419 WP_001245604.1.20465 WP_001245604.1.20492 WP_001245604.1.2053 WP_001245604.1.20635 WP_001245604.1.2073 WP_001245604.1.20740 WP_001245604.1.20828 WP_001245604.1.2087 WP_001245604.1.20883 WP_001245604.1.20947 WP_001245604.1.20953 WP_001245604.1.2106 WP_001245604.1.21062 WP_001245604.1.21162 WP_001245604.1.21184 WP_001245604.1.21185 WP_001245604.1.21366 WP_001245604.1.21492 WP_001245604.1.2166 WP_001245604.1.21674 WP_001245604.1.21886 WP_001245604.1.21940 WP_001245604.1.21946 WP_001245604.1.21966 WP_001245604.1.22064 WP_001245604.1.22118 WP_001245604.1.22126 WP_001245604.1.2216 WP_001245604.1.22208 WP_001245604.1.2227 WP_001245604.1.22373 WP_001245604.1.22476 WP_001245604.1.22614 WP_001245604.1.22652 WP_001245604.1.2284 WP_001245604.1.22895 WP_001245604.1.22926 WP_001245604.1.22943 WP_001245604.1.22967 WP_001245604.1.23040 WP_001245604.1.23058 WP_001245604.1.23218 WP_001245604.1.23279 WP_001245604.1.2331 WP_001245604.1.2332 WP_001245604.1.23340 WP_001245604.1.2336 WP_001245604.1.23365 WP_001245604.1.23412 WP_001245604.1.23426 WP_001245604.1.23492 WP_001245604.1.23515 WP_001245604.1.23548 WP_001245604.1.23571 WP_001245604.1.23604 WP_001245604.1.23639 WP_001245604.1.23679 WP_001245604.1.23728 WP_001245604.1.2375 WP_001245604.1.23783 WP_001245604.1.23786 WP_001245604.1.23801 WP_001245604.1.24028 WP_001245604.1.24061 WP_001245604.1.24083 WP_001245604.1.24117 WP_001245604.1.24125 WP_001245604.1.24138 WP_001245604.1.2415 WP_001245604.1.24153 WP_001245604.1.24291 WP_001245604.1.24322 WP_001245604.1.24355 WP_001245604.1.24375 WP_001245604.1.24400 WP_001245604.1.24420 WP_001245604.1.24567 WP_001245604.1.24619 WP_001245604.1.24643 WP_001245604.1.24688 WP_001245604.1.24689 WP_001245604.1.24716 WP_001245604.1.2481 WP_001245604.1.24832 WP_001245604.1.24964 WP_001245604.1.25017 WP_001245604.1.25032 WP_001245604.1.25041 WP_001245604.1.25053 WP_001245604.1.25130 WP_001245604.1.25140 WP_001245604.1.25185 WP_001245604.1.25210 WP_001245604.1.25219 WP_001245604.1.25304 WP_001245604.1.25374 WP_001245604.1.25475 WP_001245604.1.25490 WP_001245604.1.25508 WP_001245604.1.25603 WP_001245604.1.2562 WP_001245604.1.25666 WP_001245604.1.25807 WP_001245604.1.25821 WP_001245604.1.25833 WP_001245604.1.25835 WP_001245604.1.25882 WP_001245604.1.25962 WP_001245604.1.25963 WP_001245604.1.26001 WP_001245604.1.26027 WP_001245604.1.26107 WP_001245604.1.2615 WP_001245604.1.26199 WP_001245604.1.26217 WP_001245604.1.26230 WP_001245604.1.26232 WP_001245604.1.26272 WP_001245604.1.26286 WP_001245604.1.26288 WP_001245604.1.26491 WP_001245604.1.2654 WP_001245604.1.26554 WP_001245604.1.26636 WP_001245604.1.26689 WP_001245604.1.2679 WP_001245604.1.26908 WP_001245604.1.2692 WP_001245604.1.26928 WP_001245604.1.270 WP_001245604.1.27008 WP_001245604.1.27027 WP_001245604.1.27051 WP_001245604.1.27077 WP_001245604.1.27086 WP_001245604.1.27087 WP_001245604.1.27111 WP_001245604.1.27115 WP_001245604.1.2713 WP_001245604.1.2717 WP_001245604.1.27228 WP_001245604.1.27282 WP_001245604.1.27285 WP_001245604.1.27309 WP_001245604.1.27329 WP_001245604.1.27361 WP_001245604.1.27452 WP_001245604.1.27565 WP_001245604.1.27595 WP_001245604.1.27598 WP_001245604.1.27706 WP_001245604.1.27775 WP_001245604.1.27785 WP_001245604.1.27798 WP_001245604.1.27900 WP_001245604.1.27928 WP_001245604.1.27945 WP_001245604.1.27969 WP_001245604.1.28004 WP_001245604.1.2809 WP_001245604.1.28155 WP_001245604.1.28198 WP_001245604.1.2822 WP_001245604.1.28229 WP_001245604.1.28384 WP_001245604.1.28386 WP_001245604.1.28395 WP_001245604.1.284 WP_001245604.1.2845 WP_001245604.1.28479 WP_001245604.1.28514 WP_001245604.1.28627 WP_001245604.1.28692 WP_001245604.1.2873 WP_001245604.1.28917 WP_001245604.1.28962 WP_001245604.1.29023 WP_001245604.1.29042 WP_001245604.1.2905 WP_001245604.1.2907 WP_001245604.1.29081 WP_001245604.1.29089 WP_001245604.1.29153 WP_001245604.1.29203 WP_001245604.1.29237 WP_001245604.1.29248 WP_001245604.1.29288 WP_001245604.1.29389 WP_001245604.1.29439 WP_001245604.1.2946 WP_001245604.1.29462 WP_001245604.1.29563 WP_001245604.1.29727 WP_001245604.1.29743 WP_001245604.1.29782 WP_001245604.1.29833 WP_001245604.1.2984 WP_001245604.1.29845 WP_001245604.1.29851 WP_001245604.1.29865 WP_001245604.1.29886 WP_001245604.1.29919 WP_001245604.1.2994 WP_001245604.1.29964 WP_001245604.1.29983 WP_001245604.1.30009 WP_001245604.1.30013 WP_001245604.1.3002 WP_001245604.1.30034 WP_001245604.1.30049 WP_001245604.1.30058 WP_001245604.1.30172 WP_001245604.1.30185 WP_001245604.1.30354 WP_001245604.1.30357 WP_001245604.1.30386 WP_001245604.1.3042 WP_001245604.1.30421 WP_001245604.1.30440 WP_001245604.1.30448 WP_001245604.1.30489 WP_001245604.1.30517 WP_001245604.1.30542 WP_001245604.1.30544 WP_001245604.1.30556 WP_001245604.1.30572 WP_001245604.1.30585 WP_001245604.1.30618 WP_001245604.1.30664 WP_001245604.1.30688 WP_001245604.1.30819 WP_001245604.1.30967 WP_001245604.1.31001 WP_001245604.1.31046 WP_001245604.1.31066 WP_001245604.1.31078 WP_001245604.1.31139 WP_001245604.1.31145 WP_001245604.1.31182 WP_001245604.1.31205 WP_001245604.1.3121 WP_001245604.1.31223 WP_001245604.1.31303 WP_001245604.1.3131 WP_001245604.1.31352 WP_001245604.1.31389 WP_001245604.1.31413 WP_001245604.1.31446 WP_001245604.1.31533 WP_001245604.1.31799 WP_001245604.1.31836 WP_001245604.1.31951 WP_001245604.1.32006 WP_001245604.1.32041 WP_001245604.1.32042 WP_001245604.1.3207 WP_001245604.1.32189 WP_001245604.1.32202 WP_001245604.1.32263 WP_001245604.1.32293 WP_001245604.1.32299 WP_001245604.1.32422 WP_001245604.1.32425 WP_001245604.1.32458 WP_001245604.1.32460 WP_001245604.1.32529 WP_001245604.1.32563 WP_001245604.1.32578 WP_001245604.1.32617 WP_001245604.1.3270 WP_001245604.1.32725 WP_001245604.1.32838 WP_001245604.1.32848 WP_001245604.1.3290 WP_001245604.1.32940 WP_001245604.1.32941 WP_001245604.1.3296 WP_001245604.1.32966 WP_001245604.1.32985 WP_001245604.1.33037 WP_001245604.1.3305 WP_001245604.1.33051 WP_001245604.1.33122 WP_001245604.1.3315 WP_001245604.1.33208 WP_001245604.1.33214 WP_001245604.1.33247 WP_001245604.1.33280 WP_001245604.1.33313 WP_001245604.1.33339 WP_001245604.1.33382 WP_001245604.1.33486 WP_001245604.1.33490 WP_001245604.1.33501 WP_001245604.1.33529 WP_001245604.1.33689 WP_001245604.1.3370 WP_001245604.1.33730 WP_001245604.1.33741 WP_001245604.1.33840 WP_001245604.1.3392 WP_001245604.1.33957 WP_001245604.1.33969 WP_001245604.1.34059 WP_001245604.1.34081 WP_001245604.1.34118 WP_001245604.1.34211 WP_001245604.1.34214 WP_001245604.1.34234 WP_001245604.1.34304 WP_001245604.1.34382 WP_001245604.1.34484 WP_001245604.1.34517 WP_001245604.1.34530 WP_001245604.1.34665 WP_001245604.1.34694 WP_001245604.1.34704 WP_001245604.1.34751 WP_001245604.1.34808 WP_001245604.1.34824 WP_001245604.1.34834 WP_001245604.1.34932 WP_001245604.1.34962 WP_001245604.1.35001 WP_001245604.1.35040 WP_001245604.1.35074 WP_001245604.1.35175 WP_001245604.1.35240 WP_001245604.1.35532 WP_001245604.1.35560 WP_001245604.1.3557 WP_001245604.1.35628 WP_001245604.1.35712 WP_001245604.1.35713 WP_001245604.1.35736 WP_001245604.1.35791 WP_001245604.1.35795 WP_001245604.1.35870 WP_001245604.1.35916 WP_001245604.1.35938 WP_001245604.1.35966 WP_001245604.1.36000 WP_001245604.1.36034 WP_001245604.1.36036 WP_001245604.1.36069 WP_001245604.1.36172 WP_001245604.1.36286 WP_001245604.1.36291 WP_001245604.1.36298 WP_001245604.1.36323 WP_001245604.1.36343 WP_001245604.1.36460 WP_001245604.1.3649 WP_001245604.1.36495 WP_001245604.1.36526 WP_001245604.1.36567 WP_001245604.1.36579 WP_001245604.1.36617 WP_001245604.1.36618 WP_001245604.1.36643 WP_001245604.1.36663 WP_001245604.1.36701 WP_001245604.1.36725 WP_001245604.1.36798 WP_001245604.1.36802 WP_001245604.1.36821 WP_001245604.1.36853 WP_001245604.1.37014 WP_001245604.1.37176 WP_001245604.1.37199 WP_001245604.1.37200 WP_001245604.1.37258 WP_001245604.1.37267 WP_001245604.1.37303 WP_001245604.1.37513 WP_001245604.1.37584 WP_001245604.1.37590 WP_001245604.1.37593 WP_001245604.1.37600 WP_001245604.1.37613 WP_001245604.1.37659 WP_001245604.1.37662 WP_001245604.1.37675 WP_001245604.1.37691 WP_001245604.1.37761 WP_001245604.1.37775 WP_001245604.1.37777 WP_001245604.1.378 WP_001245604.1.379 WP_001245604.1.37941 WP_001245604.1.37985 WP_001245604.1.38061 WP_001245604.1.38064 WP_001245604.1.38108 WP_001245604.1.3816 WP_001245604.1.38207 WP_001245604.1.38261 WP_001245604.1.38266 WP_001245604.1.38310 WP_001245604.1.3834 WP_001245604.1.38351 WP_001245604.1.3838 WP_001245604.1.38381 WP_001245604.1.38440 WP_001245604.1.38486 WP_001245604.1.38515 WP_001245604.1.38595 WP_001245604.1.3860 WP_001245604.1.38642 WP_001245604.1.38734 WP_001245604.1.38877 WP_001245604.1.38983 WP_001245604.1.38996 WP_001245604.1.39056 WP_001245604.1.3907 WP_001245604.1.39105 WP_001245604.1.3914 WP_001245604.1.39140 WP_001245604.1.39147 WP_001245604.1.39161 WP_001245604.1.39210 WP_001245604.1.3931 WP_001245604.1.39435 WP_001245604.1.39502 WP_001245604.1.39530 WP_001245604.1.39620 WP_001245604.1.39659 WP_001245604.1.39667 WP_001245604.1.39775 WP_001245604.1.39879 WP_001245604.1.39890 WP_001245604.1.39941 WP_001245604.1.39945 WP_001245604.1.39947 WP_001245604.1.40095 WP_001245604.1.40097 WP_001245604.1.401 WP_001245604.1.40160 WP_001245604.1.40167 WP_001245604.1.40279 WP_001245604.1.40361 WP_001245604.1.4042 WP_001245604.1.40467 WP_001245604.1.40496 WP_001245604.1.40517 WP_001245604.1.40698 WP_001245604.1.40750 WP_001245604.1.40763 WP_001245604.1.40854 WP_001245604.1.4089 WP_001245604.1.40924 WP_001245604.1.40932 WP_001245604.1.40946 WP_001245604.1.41004 WP_001245604.1.4106 WP_001245604.1.41070 WP_001245604.1.41074 WP_001245604.1.41075 WP_001245604.1.41097 WP_001245604.1.41132 WP_001245604.1.41176 WP_001245604.1.41251 WP_001245604.1.41258 WP_001245604.1.41299 WP_001245604.1.41305 WP_001245604.1.41321 WP_001245604.1.41333 WP_001245604.1.41335 WP_001245604.1.4136 WP_001245604.1.41415 WP_001245604.1.41498 WP_001245604.1.41519 WP_001245604.1.41524 WP_001245604.1.41631 WP_001245604.1.41658 WP_001245604.1.41659 WP_001245604.1.41716 WP_001245604.1.41746 WP_001245604.1.41824 WP_001245604.1.41825 WP_001245604.1.41836 WP_001245604.1.41919 WP_001245604.1.41929 WP_001245604.1.4194 WP_001245604.1.42069 WP_001245604.1.42090 WP_001245604.1.42111 WP_001245604.1.42187 WP_001245604.1.42200 WP_001245604.1.42219 WP_001245604.1.42257 WP_001245604.1.42261 WP_001245604.1.42262 WP_001245604.1.42349 WP_001245604.1.42364 WP_001245604.1.42371 WP_001245604.1.42379 WP_001245604.1.42391 WP_001245604.1.42404 WP_001245604.1.42539 WP_001245604.1.42603 WP_001245604.1.42650 WP_001245604.1.4267 WP_001245604.1.42701 WP_001245604.1.42805 WP_001245604.1.42815 WP_001245604.1.42859 WP_001245604.1.42981 WP_001245604.1.43008 WP_001245604.1.43019 WP_001245604.1.43065 WP_001245604.1.43068 WP_001245604.1.43069 WP_001245604.1.43070 WP_001245604.1.43128 WP_001245604.1.43141 WP_001245604.1.43157 WP_001245604.1.43161 WP_001245604.1.43190 WP_001245604.1.43198 WP_001245604.1.4326 WP_001245604.1.43292 WP_001245604.1.43307 WP_001245604.1.43513 WP_001245604.1.43606 WP_001245604.1.43633 WP_001245604.1.43637 WP_001245604.1.43722 WP_001245604.1.4373 WP_001245604.1.43782 WP_001245604.1.43801 WP_001245604.1.43812 WP_001245604.1.43878 WP_001245604.1.43919 WP_001245604.1.43974 WP_001245604.1.44049 WP_001245604.1.44101 WP_001245604.1.44132 WP_001245604.1.44160 WP_001245604.1.44180 WP_001245604.1.44196 WP_001245604.1.44248 WP_001245604.1.44262 WP_001245604.1.44268 WP_001245604.1.4427 WP_001245604.1.44296 WP_001245604.1.44343 WP_001245604.1.44351 WP_001245604.1.44416 WP_001245604.1.44431 WP_001245604.1.44437 WP_001245604.1.44546 WP_001245604.1.4468 WP_001245604.1.44762 WP_001245604.1.44815 WP_001245604.1.44828 WP_001245604.1.44879 WP_001245604.1.44917 WP_001245604.1.4501 WP_001245604.1.45072 WP_001245604.1.45093 WP_001245604.1.45136 WP_001245604.1.45241 WP_001245604.1.45322 WP_001245604.1.45435 WP_001245604.1.45523 WP_001245604.1.45596 WP_001245604.1.45648 WP_001245604.1.45829 WP_001245604.1.45871 WP_001245604.1.46030 WP_001245604.1.46077 WP_001245604.1.46124 WP_001245604.1.46169 WP_001245604.1.46225 WP_001245604.1.46241 WP_001245604.1.46307 WP_001245604.1.46355 WP_001245604.1.464 WP_001245604.1.46454 WP_001245604.1.46461 WP_001245604.1.46505 WP_001245604.1.46551 WP_001245604.1.46559 WP_001245604.1.46781 WP_001245604.1.46816 WP_001245604.1.46842 WP_001245604.1.4690 WP_001245604.1.46920 WP_001245604.1.46945 WP_001245604.1.47036 WP_001245604.1.47037 WP_001245604.1.47042 WP_001245604.1.47059 WP_001245604.1.47085 WP_001245604.1.47123 WP_001245604.1.47245 WP_001245604.1.47523 WP_001245604.1.47531 WP_001245604.1.47532 WP_001245604.1.47605 WP_001245604.1.47630 WP_001245604.1.4774 WP_001245604.1.47756 WP_001245604.1.4781 WP_001245604.1.47898 WP_001245604.1.48019 WP_001245604.1.48100 WP_001245604.1.48114 WP_001245604.1.48124 WP_001245604.1.48190 WP_001245604.1.48218 WP_001245604.1.48247 WP_001245604.1.48292 WP_001245604.1.48324 WP_001245604.1.48426 WP_001245604.1.48430 WP_001245604.1.48436 WP_001245604.1.48586 WP_001245604.1.4859 WP_001245604.1.48591 WP_001245604.1.48610 WP_001245604.1.48663 WP_001245604.1.48690 WP_001245604.1.48734 WP_001245604.1.48778 WP_001245604.1.48849 WP_001245604.1.48955 WP_001245604.1.48963 WP_001245604.1.48973 WP_001245604.1.49004 WP_001245604.1.49106 WP_001245604.1.49117 WP_001245604.1.49121 WP_001245604.1.4914 WP_001245604.1.49140 WP_001245604.1.49153 WP_001245604.1.49166 WP_001245604.1.49262 WP_001245604.1.49355 WP_001245604.1.49429 WP_001245604.1.49434 WP_001245604.1.49450 WP_001245604.1.49545 WP_001245604.1.49703 WP_001245604.1.49846 WP_001245604.1.4991 WP_001245604.1.49947 WP_001245604.1.49959 WP_001245604.1.49997 WP_001245604.1.50014 WP_001245604.1.50030 WP_001245604.1.50043 WP_001245604.1.50103 WP_001245604.1.50158 WP_001245604.1.50247 WP_001245604.1.50308 WP_001245604.1.50309 WP_001245604.1.50386 WP_001245604.1.50387 WP_001245604.1.50406 WP_001245604.1.50468 WP_001245604.1.5051 WP_001245604.1.50566 WP_001245604.1.50570 WP_001245604.1.5058 WP_001245604.1.50726 WP_001245604.1.50769 WP_001245604.1.50771 WP_001245604.1.50875 WP_001245604.1.50885 WP_001245604.1.50929 WP_001245604.1.50954 WP_001245604.1.50970 WP_001245604.1.51040 WP_001245604.1.51048 WP_001245604.1.51100 WP_001245604.1.51134 WP_001245604.1.51139 WP_001245604.1.51227 WP_001245604.1.5127 WP_001245604.1.51305 WP_001245604.1.51315 WP_001245604.1.51338 WP_001245604.1.5136 WP_001245604.1.51474 WP_001245604.1.51519 WP_001245604.1.51644 WP_001245604.1.51724 WP_001245604.1.51734 WP_001245604.1.51838 WP_001245604.1.51863 WP_001245604.1.51914 WP_001245604.1.51935 WP_001245604.1.52057 WP_001245604.1.52114 WP_001245604.1.52129 WP_001245604.1.52191 WP_001245604.1.52202 WP_001245604.1.52209 WP_001245604.1.52255 WP_001245604.1.52339 WP_001245604.1.52469 WP_001245604.1.52527 WP_001245604.1.52571 WP_001245604.1.526 WP_001245604.1.52647 WP_001245604.1.52742 WP_001245604.1.52773 WP_001245604.1.52795 WP_001245604.1.52807 WP_001245604.1.53016 WP_001245604.1.53092 WP_001245604.1.53141 WP_001245604.1.53151 WP_001245604.1.53154 WP_001245604.1.53158 WP_001245604.1.53159 WP_001245604.1.53210 WP_001245604.1.53233 WP_001245604.1.53307 WP_001245604.1.53375 WP_001245604.1.53450 WP_001245604.1.5349 WP_001245604.1.53540 WP_001245604.1.53555 WP_001245604.1.53559 WP_001245604.1.5356 WP_001245604.1.53571 WP_001245604.1.5358 WP_001245604.1.53692 WP_001245604.1.53723 WP_001245604.1.5374 WP_001245604.1.53750 WP_001245604.1.53800 WP_001245604.1.53815 WP_001245604.1.53839 WP_001245604.1.53892 WP_001245604.1.53898 WP_001245604.1.53902 WP_001245604.1.53958 WP_001245604.1.53981 WP_001245604.1.53984 WP_001245604.1.54132 WP_001245604.1.54170 WP_001245604.1.54175 WP_001245604.1.54259 WP_001245604.1.5430 WP_001245604.1.54371 WP_001245604.1.54431 WP_001245604.1.54442 WP_001245604.1.54482 WP_001245604.1.54589 WP_001245604.1.54667 WP_001245604.1.54678 WP_001245604.1.54681 WP_001245604.1.54748 WP_001245604.1.5481 WP_001245604.1.54865 WP_001245604.1.5493 WP_001245604.1.54935 WP_001245604.1.54979 WP_001245604.1.54984 WP_001245604.1.55010 WP_001245604.1.55034 WP_001245604.1.55163 WP_001245604.1.55165 WP_001245604.1.55215 WP_001245604.1.55290 WP_001245604.1.55310 WP_001245604.1.55317 WP_001245604.1.55379 WP_001245604.1.5539 WP_001245604.1.55461 WP_001245604.1.55468 WP_001245604.1.55506 WP_001245604.1.55604 WP_001245604.1.55639 WP_001245604.1.55699 WP_001245604.1.55725 WP_001245604.1.55780 WP_001245604.1.55967 WP_001245604.1.56100 WP_001245604.1.56144 WP_001245604.1.56172 WP_001245604.1.56226 WP_001245604.1.56311 WP_001245604.1.56419 WP_001245604.1.56423 WP_001245604.1.56514 WP_001245604.1.56535 WP_001245604.1.56585 WP_001245604.1.56640 WP_001245604.1.56724 WP_001245604.1.56825 WP_001245604.1.56887 WP_001245604.1.56981 WP_001245604.1.57101 WP_001245604.1.57137 WP_001245604.1.57147 WP_001245604.1.57179 WP_001245604.1.57186 WP_001245604.1.57342 WP_001245604.1.57684 WP_001245604.1.57699 WP_001245604.1.57785 WP_001245604.1.57800 WP_001245604.1.5781 WP_001245604.1.57965 WP_001245604.1.57972 WP_001245604.1.58008 WP_001245604.1.58044 WP_001245604.1.58081 WP_001245604.1.5809 WP_001245604.1.58132 WP_001245604.1.58173 WP_001245604.1.58191 WP_001245604.1.58194 WP_001245604.1.58252 WP_001245604.1.58261 WP_001245604.1.58274 WP_001245604.1.58282 WP_001245604.1.58324 WP_001245604.1.58326 WP_001245604.1.58357 WP_001245604.1.5836 WP_001245604.1.58485 WP_001245604.1.58537 WP_001245604.1.58568 WP_001245604.1.58583 WP_001245604.1.58652 WP_001245604.1.58663 WP_001245604.1.58724 WP_001245604.1.58729 WP_001245604.1.5875 WP_001245604.1.58796 WP_001245604.1.58807 WP_001245604.1.58831 WP_001245604.1.58847 WP_001245604.1.58883 WP_001245604.1.58898 WP_001245604.1.58949 WP_001245604.1.58963 WP_001245604.1.58970 WP_001245604.1.58974 WP_001245604.1.59020 WP_001245604.1.59043 WP_001245604.1.59056 WP_001245604.1.59061 WP_001245604.1.59064 WP_001245604.1.59282 WP_001245604.1.59313 WP_001245604.1.5949 WP_001245604.1.59501 WP_001245604.1.59510 WP_001245604.1.59648 WP_001245604.1.5969 WP_001245604.1.59751 WP_001245604.1.59827 WP_001245604.1.59847 WP_001245604.1.59863 WP_001245604.1.5993 WP_001245604.1.59969 WP_001245604.1.59994 WP_001245604.1.60045 WP_001245604.1.60076 WP_001245604.1.60114 WP_001245604.1.60154 WP_001245604.1.60168 WP_001245604.1.60192 WP_001245604.1.60199 WP_001245604.1.60212 WP_001245604.1.60231 WP_001245604.1.60253 WP_001245604.1.60322 WP_001245604.1.60324 WP_001245604.1.60356 WP_001245604.1.6038 WP_001245604.1.60380 WP_001245604.1.6041 WP_001245604.1.60424 WP_001245604.1.60481 WP_001245604.1.605 WP_001245604.1.6058 WP_001245604.1.60584 WP_001245604.1.6060 WP_001245604.1.60661 WP_001245604.1.60676 WP_001245604.1.60708 WP_001245604.1.60725 WP_001245604.1.60783 WP_001245604.1.60792 WP_001245604.1.60807 WP_001245604.1.60855 WP_001245604.1.60882 WP_001245604.1.60889 WP_001245604.1.60926 WP_001245604.1.60950 WP_001245604.1.6104 WP_001245604.1.61044 WP_001245604.1.61076 WP_001245604.1.61123 WP_001245604.1.61146 WP_001245604.1.61147 WP_001245604.1.61210 WP_001245604.1.61511 WP_001245604.1.61539 WP_001245604.1.61542 WP_001245604.1.61553 WP_001245604.1.61649 WP_001245604.1.61652 WP_001245604.1.61697 WP_001245604.1.61809 WP_001245604.1.61877 WP_001245604.1.61920 WP_001245604.1.62124 WP_001245604.1.62199 WP_001245604.1.62223 WP_001245604.1.62302 WP_001245604.1.62314 WP_001245604.1.62323 WP_001245604.1.62333 WP_001245604.1.62338 WP_001245604.1.62380 WP_001245604.1.62411 WP_001245604.1.62436 WP_001245604.1.62475 WP_001245604.1.62536 WP_001245604.1.62640 WP_001245604.1.62686 WP_001245604.1.62751 WP_001245604.1.62825 WP_001245604.1.62932 WP_001245604.1.62960 WP_001245604.1.63016 WP_001245604.1.63025 WP_001245604.1.63069 WP_001245604.1.63087 WP_001245604.1.63169 WP_001245604.1.63297 WP_001245604.1.63448 WP_001245604.1.63514 WP_001245604.1.63583 WP_001245604.1.63592 WP_001245604.1.63663 WP_001245604.1.63736 WP_001245604.1.63816 WP_001245604.1.63876 WP_001245604.1.6389 WP_001245604.1.63901 WP_001245604.1.63955 WP_001245604.1.63963 WP_001245604.1.64032 WP_001245604.1.64087 WP_001245604.1.6415 WP_001245604.1.64332 WP_001245604.1.64376 WP_001245604.1.644 WP_001245604.1.64501 WP_001245604.1.64538 WP_001245604.1.64632 WP_001245604.1.64648 WP_001245604.1.64654 WP_001245604.1.64662 WP_001245604.1.64663 WP_001245604.1.64709 WP_001245604.1.64710 WP_001245604.1.64744 WP_001245604.1.64763 WP_001245604.1.64817 WP_001245604.1.64847 WP_001245604.1.6487 WP_001245604.1.64891 WP_001245604.1.64974 WP_001245604.1.65054 WP_001245604.1.65075 WP_001245604.1.6514 WP_001245604.1.65172 WP_001245604.1.65191 WP_001245604.1.65200 WP_001245604.1.65211 WP_001245604.1.65218 WP_001245604.1.65226 WP_001245604.1.65266 WP_001245604.1.65394 WP_001245604.1.65395 WP_001245604.1.65459 WP_001245604.1.65463 WP_001245604.1.65487 WP_001245604.1.6549 WP_001245604.1.65499 WP_001245604.1.6554 WP_001245604.1.65650 WP_001245604.1.65697 WP_001245604.1.65699 WP_001245604.1.65737 WP_001245604.1.65755 WP_001245604.1.65790 WP_001245604.1.65812 WP_001245604.1.65846 WP_001245604.1.65863 WP_001245604.1.65968 WP_001245604.1.65985 WP_001245604.1.66021 WP_001245604.1.66031 WP_001245604.1.66052 WP_001245604.1.66064 WP_001245604.1.66109 WP_001245604.1.66145 WP_001245604.1.66183 WP_001245604.1.6620 WP_001245604.1.66216 WP_001245604.1.66234 WP_001245604.1.66273 WP_001245604.1.66324 WP_001245604.1.6634 WP_001245604.1.66361 WP_001245604.1.66480 WP_001245604.1.66506 WP_001245604.1.66665 WP_001245604.1.66681 WP_001245604.1.66684 WP_001245604.1.66755 WP_001245604.1.66759 WP_001245604.1.66801 WP_001245604.1.66824 WP_001245604.1.66860 WP_001245604.1.66953 WP_001245604.1.66955 WP_001245604.1.66981 WP_001245604.1.67024 WP_001245604.1.67042 WP_001245604.1.67101 WP_001245604.1.67143 WP_001245604.1.67201 WP_001245604.1.67211 WP_001245604.1.67237 WP_001245604.1.67336 WP_001245604.1.67339 WP_001245604.1.67387 WP_001245604.1.67394 WP_001245604.1.67397 WP_001245604.1.67403 WP_001245604.1.67424 WP_001245604.1.67430 WP_001245604.1.67442 WP_001245604.1.67539 WP_001245604.1.67556 WP_001245604.1.67576 WP_001245604.1.67604 WP_001245604.1.67625 WP_001245604.1.67627 WP_001245604.1.67641 WP_001245604.1.67657 WP_001245604.1.67673 WP_001245604.1.67700 WP_001245604.1.67718 WP_001245604.1.67729 WP_001245604.1.67774 WP_001245604.1.67820 WP_001245604.1.67910 WP_001245604.1.67954 WP_001245604.1.68 WP_001245604.1.68043 WP_001245604.1.68105 WP_001245604.1.68113 WP_001245604.1.68115 WP_001245604.1.68131 WP_001245604.1.68182 WP_001245604.1.6819 WP_001245604.1.68285 WP_001245604.1.68359 WP_001245604.1.68420 WP_001245604.1.68478 WP_001245604.1.68514 WP_001245604.1.68564 WP_001245604.1.68688 WP_001245604.1.68742 WP_001245604.1.68770 WP_001245604.1.68809 WP_001245604.1.68914 WP_001245604.1.68999 WP_001245604.1.69053 WP_001245604.1.69170 WP_001245604.1.69210 WP_001245604.1.69270 WP_001245604.1.69282 WP_001245604.1.69376 WP_001245604.1.69396 WP_001245604.1.69466 WP_001245604.1.69597 WP_001245604.1.69611 WP_001245604.1.69642 WP_001245604.1.69656 WP_001245604.1.69657 WP_001245604.1.69690 WP_001245604.1.69923 WP_001245604.1.69948 WP_001245604.1.69953 WP_001245604.1.69982 WP_001245604.1.70010 WP_001245604.1.70049 WP_001245604.1.70058 WP_001245604.1.70061 WP_001245604.1.70205 WP_001245604.1.70240 WP_001245604.1.70249 WP_001245604.1.70261 WP_001245604.1.70314 WP_001245604.1.7033 WP_001245604.1.70427 WP_001245604.1.70433 WP_001245604.1.70545 WP_001245604.1.70623 WP_001245604.1.70644 WP_001245604.1.70671 WP_001245604.1.70679 WP_001245604.1.70731 WP_001245604.1.70772 WP_001245604.1.70845 WP_001245604.1.70846 WP_001245604.1.70969 WP_001245604.1.70981 WP_001245604.1.70995 WP_001245604.1.71039 WP_001245604.1.71057 WP_001245604.1.71081 WP_001245604.1.71117 WP_001245604.1.71186 WP_001245604.1.71456 WP_001245604.1.71487 WP_001245604.1.71500 WP_001245604.1.71523 WP_001245604.1.71542 WP_001245604.1.71566 WP_001245604.1.71640 WP_001245604.1.71651 WP_001245604.1.71653 WP_001245604.1.71716 WP_001245604.1.71872 WP_001245604.1.71950 WP_001245604.1.71954 WP_001245604.1.72003 WP_001245604.1.72073 WP_001245604.1.72269 WP_001245604.1.72383 WP_001245604.1.72461 WP_001245604.1.72527 WP_001245604.1.7255 WP_001245604.1.72631 WP_001245604.1.72638 WP_001245604.1.72667 WP_001245604.1.72674 WP_001245604.1.72724 WP_001245604.1.72789 WP_001245604.1.72828 WP_001245604.1.72896 WP_001245604.1.72969 WP_001245604.1.72987 WP_001245604.1.73052 WP_001245604.1.7311 WP_001245604.1.73114 WP_001245604.1.73177 WP_001245604.1.73180 WP_001245604.1.73258 WP_001245604.1.73270 WP_001245604.1.73285 WP_001245604.1.7332 WP_001245604.1.7333 WP_001245604.1.73352 WP_001245604.1.73389 WP_001245604.1.73425 WP_001245604.1.73488 WP_001245604.1.73504 WP_001245604.1.7353 WP_001245604.1.73544 WP_001245604.1.73598 WP_001245604.1.7361 WP_001245604.1.73648 WP_001245604.1.73768 WP_001245604.1.73849 WP_001245604.1.73948 WP_001245604.1.73999 WP_001245604.1.74024 WP_001245604.1.74030 WP_001245604.1.74038 WP_001245604.1.74043 WP_001245604.1.74058 WP_001245604.1.74070 WP_001245604.1.74077 WP_001245604.1.74135 WP_001245604.1.74214 WP_001245604.1.74241 WP_001245604.1.74285 WP_001245604.1.7430 WP_001245604.1.74415 WP_001245604.1.74500 WP_001245604.1.74570 WP_001245604.1.74616 WP_001245604.1.74621 WP_001245604.1.74647 WP_001245604.1.74677 WP_001245604.1.74699 WP_001245604.1.74831 WP_001245604.1.74894 WP_001245604.1.74929 WP_001245604.1.74973 WP_001245604.1.7507 WP_001245604.1.75114 WP_001245604.1.75116 WP_001245604.1.75237 WP_001245604.1.75273 WP_001245604.1.75296 WP_001245604.1.75413 WP_001245604.1.75433 WP_001245604.1.75565 WP_001245604.1.75593 WP_001245604.1.75610 WP_001245604.1.75633 WP_001245604.1.75664 WP_001245604.1.75718 WP_001245604.1.75745 WP_001245604.1.75844 WP_001245604.1.75886 WP_001245604.1.75898 WP_001245604.1.76081 WP_001245604.1.76116 WP_001245604.1.76122 WP_001245604.1.76186 WP_001245604.1.76256 WP_001245604.1.7629 WP_001245604.1.76339 WP_001245604.1.76366 WP_001245604.1.76417 WP_001245604.1.7646 WP_001245604.1.76558 WP_001245604.1.76572 WP_001245604.1.76641 WP_001245604.1.76651 WP_001245604.1.76653 WP_001245604.1.76788 WP_001245604.1.76854 WP_001245604.1.76916 WP_001245604.1.76932 WP_001245604.1.76973 WP_001245604.1.76988 WP_001245604.1.77016 WP_001245604.1.77087 WP_001245604.1.77090 WP_001245604.1.77111 WP_001245604.1.77299 WP_001245604.1.77501 WP_001245604.1.77512 WP_001245604.1.77513 WP_001245604.1.77563 WP_001245604.1.77702 WP_001245604.1.77713 WP_001245604.1.7772 WP_001245604.1.77825 WP_001245604.1.77900 WP_001245604.1.77923 WP_001245604.1.77975 WP_001245604.1.78035 WP_001245604.1.78048 WP_001245604.1.78107 WP_001245604.1.78166 WP_001245604.1.78168 WP_001245604.1.78192 WP_001245604.1.78195 WP_001245604.1.78291 WP_001245604.1.78309 WP_001245604.1.78320 WP_001245604.1.78382 WP_001245604.1.78388 WP_001245604.1.78410 WP_001245604.1.7862 WP_001245604.1.78661 WP_001245604.1.78674 WP_001245604.1.78676 WP_001245604.1.78761 WP_001245604.1.789 WP_001245604.1.78993 WP_001245604.1.79012 WP_001245604.1.79069 WP_001245604.1.79074 WP_001245604.1.79098 WP_001245604.1.79204 WP_001245604.1.79280 WP_001245604.1.79397 WP_001245604.1.79456 WP_001245604.1.79532 WP_001245604.1.79547 WP_001245604.1.79654 WP_001245604.1.7970 WP_001245604.1.79722 WP_001245604.1.79772 WP_001245604.1.79880 WP_001245604.1.80065 WP_001245604.1.80273 WP_001245604.1.80282 WP_001245604.1.80293 WP_001245604.1.80354 WP_001245604.1.80368 WP_001245604.1.80386 WP_001245604.1.80400 WP_001245604.1.80462 WP_001245604.1.8049 WP_001245604.1.80492 WP_001245604.1.80569 WP_001245604.1.80664 WP_001245604.1.80984 WP_001245604.1.81131 WP_001245604.1.81187 WP_001245604.1.81262 WP_001245604.1.81268 WP_001245604.1.81269 WP_001245604.1.8131 WP_001245604.1.81333 WP_001245604.1.81342 WP_001245604.1.81364 WP_001245604.1.81494 WP_001245604.1.81557 WP_001245604.1.81676 WP_001245604.1.81681 WP_001245604.1.8170 WP_001245604.1.81763 WP_001245604.1.81855 WP_001245604.1.81921 WP_001245604.1.81931 WP_001245604.1.81949 WP_001245604.1.82070 WP_001245604.1.82076 WP_001245604.1.82131 WP_001245604.1.82141 WP_001245604.1.82156 WP_001245604.1.82180 WP_001245604.1.82201 WP_001245604.1.82214 WP_001245604.1.82225 WP_001245604.1.82347 WP_001245604.1.8240 WP_001245604.1.82408 WP_001245604.1.82416 WP_001245604.1.8242 WP_001245604.1.82456 WP_001245604.1.82465 WP_001245604.1.82473 WP_001245604.1.82530 WP_001245604.1.82553 WP_001245604.1.82670 WP_001245604.1.82731 WP_001245604.1.82812 WP_001245604.1.82850 WP_001245604.1.82872 WP_001245604.1.8294 WP_001245604.1.82959 WP_001245604.1.83007 WP_001245604.1.8304 WP_001245604.1.83128 WP_001245604.1.83180 WP_001245604.1.83229 WP_001245604.1.83235 WP_001245604.1.83290 WP_001245604.1.83333 WP_001245604.1.83360 WP_001245604.1.83657 WP_001245604.1.83677 WP_001245604.1.8375 WP_001245604.1.83923 WP_001245604.1.83994 WP_001245604.1.84 WP_001245604.1.8406 WP_001245604.1.84076 WP_001245604.1.84106 WP_001245604.1.84110 WP_001245604.1.84127 WP_001245604.1.84150 WP_001245604.1.84230 WP_001245604.1.84252 WP_001245604.1.8431 WP_001245604.1.84345 WP_001245604.1.84369 WP_001245604.1.84401 WP_001245604.1.84435 WP_001245604.1.84567 WP_001245604.1.84631 WP_001245604.1.84727 WP_001245604.1.84744 WP_001245604.1.84773 WP_001245604.1.84945 WP_001245604.1.84967 WP_001245604.1.85004 WP_001245604.1.8502 WP_001245604.1.85039 WP_001245604.1.85153 WP_001245604.1.85273 WP_001245604.1.85338 WP_001245604.1.85339 WP_001245604.1.85511 WP_001245604.1.85512 WP_001245604.1.8557 WP_001245604.1.85606 WP_001245604.1.85635 WP_001245604.1.85646 WP_001245604.1.85669 WP_001245604.1.85688 WP_001245604.1.85703 WP_001245604.1.85728 WP_001245604.1.85746 WP_001245604.1.85811 WP_001245604.1.85854 WP_001245604.1.859 WP_001245604.1.8591 WP_001245604.1.85917 WP_001245604.1.8594 WP_001245604.1.85977 WP_001245604.1.860 WP_001245604.1.8605 WP_001245604.1.86084 WP_001245604.1.8610 WP_001245604.1.8614 WP_001245604.1.86156 WP_001245604.1.86323 WP_001245604.1.86342 WP_001245604.1.8640 WP_001245604.1.8642 WP_001245604.1.86426 WP_001245604.1.86489 WP_001245604.1.86530 WP_001245604.1.86770 WP_001245604.1.86794 WP_001245604.1.86800 WP_001245604.1.86811 WP_001245604.1.86815 WP_001245604.1.86945 WP_001245604.1.86989 WP_001245604.1.87023 WP_001245604.1.87034 WP_001245604.1.87041 WP_001245604.1.87136 WP_001245604.1.87148 WP_001245604.1.87155 WP_001245604.1.87258 WP_001245604.1.87293 WP_001245604.1.87346 WP_001245604.1.87370 WP_001245604.1.87420 WP_001245604.1.87528 WP_001245604.1.87560 WP_001245604.1.8760 WP_001245604.1.87600 WP_001245604.1.87609 WP_001245604.1.87612 WP_001245604.1.87615 WP_001245604.1.87626 WP_001245604.1.87653 WP_001245604.1.87659 WP_001245604.1.87698 WP_001245604.1.87706 WP_001245604.1.87739 WP_001245604.1.87741 WP_001245604.1.87742 WP_001245604.1.87852 WP_001245604.1.87949 WP_001245604.1.88025 WP_001245604.1.88026 WP_001245604.1.8805 WP_001245604.1.8806 WP_001245604.1.881 WP_001245604.1.88145 WP_001245604.1.88199 WP_001245604.1.88299 WP_001245604.1.88313 WP_001245604.1.88359 WP_001245604.1.88407 WP_001245604.1.88414 WP_001245604.1.88446 WP_001245604.1.88458 WP_001245604.1.88538 WP_001245604.1.88547 WP_001245604.1.886 WP_001245604.1.88647 WP_001245604.1.88648 WP_001245604.1.88692 WP_001245604.1.88727 WP_001245604.1.88772 WP_001245604.1.88850 WP_001245604.1.8889 WP_001245604.1.88892 WP_001245604.1.88894 WP_001245604.1.89182 WP_001245604.1.89298 WP_001245604.1.89308 WP_001245604.1.89311 WP_001245604.1.89314 WP_001245604.1.89328 WP_001245604.1.89332 WP_001245604.1.89343 WP_001245604.1.89395 WP_001245604.1.8940 WP_001245604.1.89449 WP_001245604.1.8947 WP_001245604.1.89503 WP_001245604.1.89591 WP_001245604.1.89612 WP_001245604.1.89668 WP_001245604.1.89706 WP_001245604.1.89713 WP_001245604.1.89733 WP_001245604.1.89796 WP_001245604.1.89804 WP_001245604.1.89888 WP_001245604.1.89911 WP_001245604.1.8995 WP_001245604.1.89952 WP_001245604.1.90007 WP_001245604.1.90108 WP_001245604.1.9011 WP_001245604.1.90196 WP_001245604.1.90240 WP_001245604.1.90274 WP_001245604.1.90280 WP_001245604.1.90338 WP_001245604.1.90365 WP_001245604.1.90428 WP_001245604.1.90489 WP_001245604.1.90513 WP_001245604.1.90582 WP_001245604.1.90713 WP_001245604.1.90794 WP_001245604.1.90796 WP_001245604.1.90811 WP_001245604.1.9091 WP_001245604.1.91067 WP_001245604.1.91164 WP_001245604.1.91205 WP_001245604.1.91239 WP_001245604.1.91291 WP_001245604.1.91313 WP_001245604.1.91453 WP_001245604.1.91506 WP_001245604.1.91557 WP_001245604.1.91579 WP_001245604.1.91597 WP_001245604.1.91702 WP_001245604.1.91715 WP_001245604.1.91736 WP_001245604.1.9187 WP_001245604.1.91870 WP_001245604.1.92018 WP_001245604.1.92087 WP_001245604.1.92098 WP_001245604.1.92172 WP_001245604.1.92240 WP_001245604.1.92243 WP_001245604.1.92327 WP_001245604.1.92399 WP_001245604.1.92470 WP_001245604.1.92477 WP_001245604.1.92545 WP_001245604.1.92570 WP_001245604.1.92588 WP_001245604.1.926 WP_001245604.1.92633 WP_001245604.1.92649 WP_001245604.1.92676 WP_001245604.1.92705 WP_001245604.1.9271 WP_001245604.1.92734 WP_001245604.1.92810 WP_001245604.1.92823 WP_001245604.1.92987 WP_001245604.1.93007 WP_001245604.1.93022 WP_001245604.1.93103 WP_001245604.1.93105 WP_001245604.1.93111 WP_001245604.1.93168 WP_001245604.1.93184 WP_001245604.1.93221 WP_001245604.1.93223 WP_001245604.1.93302 WP_001245604.1.93322 WP_001245604.1.9336 WP_001245604.1.93387 WP_001245604.1.93469 WP_001245604.1.93511 WP_001245604.1.93512 WP_001245604.1.93657 WP_001245604.1.9375 WP_001245604.1.93754 WP_001245604.1.93780 WP_001245604.1.93842 WP_001245604.1.93843 WP_001245604.1.93875 WP_001245604.1.93909 WP_001245604.1.93919 WP_001245604.1.93938 WP_001245604.1.93984 WP_001245604.1.9399 WP_001245604.1.94017 WP_001245604.1.94079 WP_001245604.1.94097 WP_001245604.1.94107 WP_001245604.1.94142 WP_001245604.1.94215 WP_001245604.1.94303 WP_001245604.1.94365 WP_001245604.1.94390 WP_001245604.1.94415 WP_001245604.1.94492 WP_001245604.1.94510 WP_001245604.1.94573 WP_001245604.1.94579 WP_001245604.1.94586 WP_001245604.1.94593 WP_001245604.1.94650 WP_001245604.1.94659 WP_001245604.1.94662 WP_001245604.1.94700 WP_001245604.1.94745 WP_001245604.1.94782 WP_001245604.1.94815 WP_001245604.1.94820 WP_001245604.1.94850 WP_001245604.1.94851 WP_001245604.1.94864 WP_001245604.1.94952 WP_001245604.1.94987 WP_001245604.1.95006 WP_001245604.1.95055 WP_001245604.1.95076 WP_001245604.1.95099 WP_001245604.1.95165 WP_001245604.1.95239 WP_001245604.1.95246 WP_001245604.1.9525 WP_001245604.1.95255 WP_001245604.1.95265 WP_001245604.1.95298 WP_001245604.1.95338 WP_001245604.1.95412 WP_001245604.1.95530 WP_001245604.1.95547 WP_001245604.1.95590 WP_001245604.1.95625 WP_001245604.1.95716 WP_001245604.1.95884 WP_001245604.1.95890 WP_001245604.1.95906 WP_001245604.1.96025 WP_001245604.1.96044 WP_001245604.1.96045 WP_001245604.1.96054 WP_001245604.1.96127 WP_001245604.1.96141 WP_001245604.1.96144 WP_001245604.1.96188 WP_001245604.1.96211 WP_001245604.1.96212 WP_001245604.1.96319 WP_001245604.1.9633 WP_001245604.1.96359 WP_001245604.1.96533 WP_001245604.1.96539 WP_001245604.1.96552 WP_001245604.1.96610 WP_001245604.1.96625 WP_001245604.1.96635 WP_001245604.1.9664 WP_001245604.1.96662 WP_001245604.1.9670 WP_001245604.1.96750 WP_001245604.1.96792 WP_001245604.1.96801 WP_001245604.1.96803 WP_001245604.1.9686 WP_001245604.1.96938 WP_001245604.1.96946 WP_001245604.1.96957 WP_001245604.1.96978 WP_001245604.1.97026 WP_001245604.1.97028 WP_001245604.1.97079 WP_001245604.1.97154 WP_001245604.1.97184 WP_001245604.1.97260 WP_001245604.1.97287 WP_001245604.1.97441 WP_001245604.1.97497 WP_001245604.1.97505 WP_001245604.1.97599 WP_001245604.1.97606 WP_001245604.1.97646 WP_001245604.1.97690 WP_001245604.1.97819 WP_001245604.1.97840 WP_001245604.1.97938 WP_001245604.1.97986 WP_001245604.1.98036 WP_001245604.1.98080 WP_001245604.1.98086 WP_001245604.1.9811 WP_001245604.1.98158 WP_001245604.1.98263 WP_001245604.1.98392 WP_001245604.1.98418 WP_001245604.1.98448 WP_001245604.1.98457 WP_001245604.1.9850 WP_001245604.1.98502 WP_001245604.1.98607 WP_001245604.1.98731 WP_001245604.1.98762 WP_001245604.1.9877 WP_001245604.1.98801 WP_001245604.1.98818 WP_001245604.1.99163 WP_001245604.1.99335 WP_001245604.1.99350 WP_001245604.1.99363 WP_001245604.1.99369 WP_001245604.1.99397 WP_001245604.1.99463 WP_001245604.1.99483 WP_001245604.1.99546 WP_001245604.1.99579 WP_001245604.1.99595 WP_001245604.1.99671 WP_001245604.1.99676 WP_001245604.1.99764 WP_001245604.1.99829 WP_001245604.1.99837 WP_001245604.1.9992 WP_001245604.1.99996 209261.t2265 220341.STY0647 gi|488654763|ref|YP_007926566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]