SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759687|ref|NP_455304.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759687|ref|NP_455304.1|
Domain Number 1 Region: 155-428
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.83e-55
Family Tricorn protease N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 28-161
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 1.7e-39
Family TolB, N-terminal domain 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16759687|ref|NP_455304.1|
Sequence length 430
Comment TolB protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKWAGPGAAPEDIGGIVAA
DLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVIVGLVTPNPDGSYNVAYQLVD
TGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPY
ELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVA
SFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQIRQITDGRSNNTEPTWFPDSQ
TLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQNQDADVSSDGKFMVMVSSNNGQQHIAK
QDLVTGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQ
VKSPAWSPYL
Download sequence
Identical sequences Q8Z8C0
AE014613|CDS_2190431-2189139 AL513382|CDS_790658-791950 209261.t2128 220341.STY0794 gi|29142540|ref|NP_805882.1| gi|16759687|ref|NP_455304.1| NP_455304.1.84458 WP_010989131.1.100008 WP_010989131.1.100036 WP_010989131.1.100079 WP_010989131.1.100196 WP_010989131.1.100284 WP_010989131.1.100313 WP_010989131.1.100314 WP_010989131.1.100321 WP_010989131.1.100354 WP_010989131.1.100421 WP_010989131.1.100446 WP_010989131.1.100450 WP_010989131.1.100592 WP_010989131.1.100610 WP_010989131.1.100732 WP_010989131.1.100733 WP_010989131.1.100739 WP_010989131.1.100764 WP_010989131.1.100799 WP_010989131.1.100941 WP_010989131.1.100953 WP_010989131.1.101011 WP_010989131.1.10108 WP_010989131.1.101226 WP_010989131.1.10124 WP_010989131.1.101271 WP_010989131.1.101312 WP_010989131.1.101322 WP_010989131.1.101374 WP_010989131.1.101616 WP_010989131.1.101890 WP_010989131.1.101941 WP_010989131.1.102050 WP_010989131.1.102087 WP_010989131.1.10338 WP_010989131.1.1038 WP_010989131.1.104 WP_010989131.1.10401 WP_010989131.1.10428 WP_010989131.1.10459 WP_010989131.1.10475 WP_010989131.1.10511 WP_010989131.1.10514 WP_010989131.1.10530 WP_010989131.1.10532 WP_010989131.1.10547 WP_010989131.1.10595 WP_010989131.1.10642 WP_010989131.1.10654 WP_010989131.1.10677 WP_010989131.1.10857 WP_010989131.1.10873 WP_010989131.1.10926 WP_010989131.1.10936 WP_010989131.1.11012 WP_010989131.1.11055 WP_010989131.1.11126 WP_010989131.1.11142 WP_010989131.1.11239 WP_010989131.1.11253 WP_010989131.1.11314 WP_010989131.1.11385 WP_010989131.1.1142 WP_010989131.1.11426 WP_010989131.1.11429 WP_010989131.1.11557 WP_010989131.1.11567 WP_010989131.1.11638 WP_010989131.1.11883 WP_010989131.1.11908 WP_010989131.1.11914 WP_010989131.1.12040 WP_010989131.1.12061 WP_010989131.1.1207 WP_010989131.1.12141 WP_010989131.1.12172 WP_010989131.1.12192 WP_010989131.1.1224 WP_010989131.1.12364 WP_010989131.1.12398 WP_010989131.1.12441 WP_010989131.1.12581 WP_010989131.1.12620 WP_010989131.1.12648 WP_010989131.1.12683 WP_010989131.1.12726 WP_010989131.1.12727 WP_010989131.1.12741 WP_010989131.1.12834 WP_010989131.1.13108 WP_010989131.1.13161 WP_010989131.1.1321 WP_010989131.1.13268 WP_010989131.1.13291 WP_010989131.1.133 WP_010989131.1.13314 WP_010989131.1.13338 WP_010989131.1.13342 WP_010989131.1.13352 WP_010989131.1.13406 WP_010989131.1.13440 WP_010989131.1.13443 WP_010989131.1.13476 WP_010989131.1.13599 WP_010989131.1.13686 WP_010989131.1.1372 WP_010989131.1.13732 WP_010989131.1.1382 WP_010989131.1.1397 WP_010989131.1.13972 WP_010989131.1.140 WP_010989131.1.1401 WP_010989131.1.1408 WP_010989131.1.14089 WP_010989131.1.14099 WP_010989131.1.14120 WP_010989131.1.14123 WP_010989131.1.14150 WP_010989131.1.14191 WP_010989131.1.14197 WP_010989131.1.14280 WP_010989131.1.14333 WP_010989131.1.14399 WP_010989131.1.14444 WP_010989131.1.14467 WP_010989131.1.14474 WP_010989131.1.14500 WP_010989131.1.14526 WP_010989131.1.14550 WP_010989131.1.14575 WP_010989131.1.14701 WP_010989131.1.14703 WP_010989131.1.14719 WP_010989131.1.1473 WP_010989131.1.14765 WP_010989131.1.14810 WP_010989131.1.14877 WP_010989131.1.14894 WP_010989131.1.14930 WP_010989131.1.14947 WP_010989131.1.14948 WP_010989131.1.15184 WP_010989131.1.15244 WP_010989131.1.15265 WP_010989131.1.15362 WP_010989131.1.15415 WP_010989131.1.15423 WP_010989131.1.15433 WP_010989131.1.15439 WP_010989131.1.15487 WP_010989131.1.15535 WP_010989131.1.15581 WP_010989131.1.15597 WP_010989131.1.15710 WP_010989131.1.15717 WP_010989131.1.15905 WP_010989131.1.15912 WP_010989131.1.15970 WP_010989131.1.16046 WP_010989131.1.16051 WP_010989131.1.16058 WP_010989131.1.16150 WP_010989131.1.16155 WP_010989131.1.1626 WP_010989131.1.16264 WP_010989131.1.16344 WP_010989131.1.16461 WP_010989131.1.16462 WP_010989131.1.16465 WP_010989131.1.16522 WP_010989131.1.16588 WP_010989131.1.16658 WP_010989131.1.16666 WP_010989131.1.16673 WP_010989131.1.1674 WP_010989131.1.16767 WP_010989131.1.16781 WP_010989131.1.16879 WP_010989131.1.16893 WP_010989131.1.16905 WP_010989131.1.16948 WP_010989131.1.17049 WP_010989131.1.17058 WP_010989131.1.17078 WP_010989131.1.17202 WP_010989131.1.17219 WP_010989131.1.1722 WP_010989131.1.17302 WP_010989131.1.17308 WP_010989131.1.17368 WP_010989131.1.17405 WP_010989131.1.17406 WP_010989131.1.17513 WP_010989131.1.17543 WP_010989131.1.17563 WP_010989131.1.17578 WP_010989131.1.17622 WP_010989131.1.17659 WP_010989131.1.17667 WP_010989131.1.17686 WP_010989131.1.17741 WP_010989131.1.17840 WP_010989131.1.17956 WP_010989131.1.18005 WP_010989131.1.1801 WP_010989131.1.18021 WP_010989131.1.18099 WP_010989131.1.18124 WP_010989131.1.18144 WP_010989131.1.18173 WP_010989131.1.18270 WP_010989131.1.18280 WP_010989131.1.18328 WP_010989131.1.18358 WP_010989131.1.18370 WP_010989131.1.18406 WP_010989131.1.18474 WP_010989131.1.18513 WP_010989131.1.18610 WP_010989131.1.18678 WP_010989131.1.18722 WP_010989131.1.18766 WP_010989131.1.1880 WP_010989131.1.1885 WP_010989131.1.18860 WP_010989131.1.18922 WP_010989131.1.18959 WP_010989131.1.19001 WP_010989131.1.19006 WP_010989131.1.19044 WP_010989131.1.19084 WP_010989131.1.19187 WP_010989131.1.19228 WP_010989131.1.19288 WP_010989131.1.19300 WP_010989131.1.19422 WP_010989131.1.19454 WP_010989131.1.19456 WP_010989131.1.19496 WP_010989131.1.19535 WP_010989131.1.19538 WP_010989131.1.19589 WP_010989131.1.19663 WP_010989131.1.19686 WP_010989131.1.19731 WP_010989131.1.19794 WP_010989131.1.1992 WP_010989131.1.19999 WP_010989131.1.20254 WP_010989131.1.20255 WP_010989131.1.20296 WP_010989131.1.20339 WP_010989131.1.20419 WP_010989131.1.20465 WP_010989131.1.20492 WP_010989131.1.2053 WP_010989131.1.20635 WP_010989131.1.20718 WP_010989131.1.2073 WP_010989131.1.20740 WP_010989131.1.20828 WP_010989131.1.2087 WP_010989131.1.20883 WP_010989131.1.20947 WP_010989131.1.20953 WP_010989131.1.21010 WP_010989131.1.2106 WP_010989131.1.21062 WP_010989131.1.21144 WP_010989131.1.21162 WP_010989131.1.21184 WP_010989131.1.21185 WP_010989131.1.21366 WP_010989131.1.21492 WP_010989131.1.2166 WP_010989131.1.21674 WP_010989131.1.21946 WP_010989131.1.21966 WP_010989131.1.22064 WP_010989131.1.22118 WP_010989131.1.22126 WP_010989131.1.2216 WP_010989131.1.22208 WP_010989131.1.2227 WP_010989131.1.22373 WP_010989131.1.22476 WP_010989131.1.22614 WP_010989131.1.22652 WP_010989131.1.22683 WP_010989131.1.2284 WP_010989131.1.22895 WP_010989131.1.22926 WP_010989131.1.22943 WP_010989131.1.22967 WP_010989131.1.23040 WP_010989131.1.23058 WP_010989131.1.23218 WP_010989131.1.2331 WP_010989131.1.2332 WP_010989131.1.23340 WP_010989131.1.2336 WP_010989131.1.23365 WP_010989131.1.23412 WP_010989131.1.23426 WP_010989131.1.23492 WP_010989131.1.23515 WP_010989131.1.23548 WP_010989131.1.23571 WP_010989131.1.23604 WP_010989131.1.23679 WP_010989131.1.23728 WP_010989131.1.2375 WP_010989131.1.23783 WP_010989131.1.23786 WP_010989131.1.23787 WP_010989131.1.23801 WP_010989131.1.24028 WP_010989131.1.24061 WP_010989131.1.24083 WP_010989131.1.24117 WP_010989131.1.24125 WP_010989131.1.24138 WP_010989131.1.24153 WP_010989131.1.24291 WP_010989131.1.24322 WP_010989131.1.24355 WP_010989131.1.24375 WP_010989131.1.24400 WP_010989131.1.24420 WP_010989131.1.24619 WP_010989131.1.24643 WP_010989131.1.24688 WP_010989131.1.24716 WP_010989131.1.2481 WP_010989131.1.24832 WP_010989131.1.24964 WP_010989131.1.25017 WP_010989131.1.25032 WP_010989131.1.25041 WP_010989131.1.25053 WP_010989131.1.25140 WP_010989131.1.25185 WP_010989131.1.25196 WP_010989131.1.25210 WP_010989131.1.25219 WP_010989131.1.25304 WP_010989131.1.25374 WP_010989131.1.25475 WP_010989131.1.25490 WP_010989131.1.25508 WP_010989131.1.25512 WP_010989131.1.25603 WP_010989131.1.2562 WP_010989131.1.25666 WP_010989131.1.25807 WP_010989131.1.25821 WP_010989131.1.25833 WP_010989131.1.25835 WP_010989131.1.25882 WP_010989131.1.25911 WP_010989131.1.25962 WP_010989131.1.25963 WP_010989131.1.26001 WP_010989131.1.26027 WP_010989131.1.26107 WP_010989131.1.2615 WP_010989131.1.26217 WP_010989131.1.26230 WP_010989131.1.26232 WP_010989131.1.26272 WP_010989131.1.26286 WP_010989131.1.26288 WP_010989131.1.26394 WP_010989131.1.26491 WP_010989131.1.2654 WP_010989131.1.26554 WP_010989131.1.26636 WP_010989131.1.26689 WP_010989131.1.2679 WP_010989131.1.26908 WP_010989131.1.2692 WP_010989131.1.26928 WP_010989131.1.270 WP_010989131.1.27008 WP_010989131.1.27027 WP_010989131.1.27070 WP_010989131.1.27077 WP_010989131.1.27086 WP_010989131.1.27087 WP_010989131.1.27111 WP_010989131.1.27115 WP_010989131.1.2713 WP_010989131.1.2717 WP_010989131.1.27228 WP_010989131.1.27282 WP_010989131.1.27285 WP_010989131.1.27309 WP_010989131.1.27329 WP_010989131.1.27361 WP_010989131.1.27565 WP_010989131.1.27595 WP_010989131.1.27598 WP_010989131.1.27706 WP_010989131.1.27775 WP_010989131.1.27785 WP_010989131.1.27900 WP_010989131.1.27928 WP_010989131.1.27945 WP_010989131.1.28004 WP_010989131.1.2809 WP_010989131.1.28155 WP_010989131.1.28198 WP_010989131.1.2822 WP_010989131.1.28229 WP_010989131.1.28384 WP_010989131.1.28386 WP_010989131.1.28395 WP_010989131.1.284 WP_010989131.1.2845 WP_010989131.1.28479 WP_010989131.1.28627 WP_010989131.1.28692 WP_010989131.1.2873 WP_010989131.1.28917 WP_010989131.1.28962 WP_010989131.1.29023 WP_010989131.1.29042 WP_010989131.1.2905 WP_010989131.1.2907 WP_010989131.1.29081 WP_010989131.1.29089 WP_010989131.1.29153 WP_010989131.1.29203 WP_010989131.1.29237 WP_010989131.1.29248 WP_010989131.1.29288 WP_010989131.1.29389 WP_010989131.1.29439 WP_010989131.1.2946 WP_010989131.1.29462 WP_010989131.1.29563 WP_010989131.1.29727 WP_010989131.1.29743 WP_010989131.1.29782 WP_010989131.1.29833 WP_010989131.1.29851 WP_010989131.1.29865 WP_010989131.1.29886 WP_010989131.1.29919 WP_010989131.1.2994 WP_010989131.1.29964 WP_010989131.1.29983 WP_010989131.1.30009 WP_010989131.1.30013 WP_010989131.1.3002 WP_010989131.1.30034 WP_010989131.1.30049 WP_010989131.1.30058 WP_010989131.1.30172 WP_010989131.1.30185 WP_010989131.1.30354 WP_010989131.1.30357 WP_010989131.1.30362 WP_010989131.1.3042 WP_010989131.1.30421 WP_010989131.1.30440 WP_010989131.1.30448 WP_010989131.1.30489 WP_010989131.1.30517 WP_010989131.1.30542 WP_010989131.1.30544 WP_010989131.1.30556 WP_010989131.1.30572 WP_010989131.1.30585 WP_010989131.1.30618 WP_010989131.1.30664 WP_010989131.1.30688 WP_010989131.1.30806 WP_010989131.1.30967 WP_010989131.1.31046 WP_010989131.1.31066 WP_010989131.1.31078 WP_010989131.1.31139 WP_010989131.1.31145 WP_010989131.1.31182 WP_010989131.1.31205 WP_010989131.1.3121 WP_010989131.1.31223 WP_010989131.1.31303 WP_010989131.1.3131 WP_010989131.1.31352 WP_010989131.1.31389 WP_010989131.1.31413 WP_010989131.1.31446 WP_010989131.1.31533 WP_010989131.1.31799 WP_010989131.1.31836 WP_010989131.1.31951 WP_010989131.1.32041 WP_010989131.1.32042 WP_010989131.1.3207 WP_010989131.1.32189 WP_010989131.1.32202 WP_010989131.1.32263 WP_010989131.1.32293 WP_010989131.1.32299 WP_010989131.1.32422 WP_010989131.1.32425 WP_010989131.1.32458 WP_010989131.1.32460 WP_010989131.1.32529 WP_010989131.1.32563 WP_010989131.1.32578 WP_010989131.1.32617 WP_010989131.1.3270 WP_010989131.1.32725 WP_010989131.1.32838 WP_010989131.1.32848 WP_010989131.1.32868 WP_010989131.1.3290 WP_010989131.1.32940 WP_010989131.1.32941 WP_010989131.1.3296 WP_010989131.1.32966 WP_010989131.1.32985 WP_010989131.1.33037 WP_010989131.1.3305 WP_010989131.1.33051 WP_010989131.1.33065 WP_010989131.1.33122 WP_010989131.1.3315 WP_010989131.1.33208 WP_010989131.1.33214 WP_010989131.1.33247 WP_010989131.1.33280 WP_010989131.1.33283 WP_010989131.1.33313 WP_010989131.1.33339 WP_010989131.1.33382 WP_010989131.1.33490 WP_010989131.1.33501 WP_010989131.1.33529 WP_010989131.1.33689 WP_010989131.1.3370 WP_010989131.1.33730 WP_010989131.1.33741 WP_010989131.1.33840 WP_010989131.1.3392 WP_010989131.1.33926 WP_010989131.1.33957 WP_010989131.1.33969 WP_010989131.1.34001 WP_010989131.1.34059 WP_010989131.1.34118 WP_010989131.1.34211 WP_010989131.1.34214 WP_010989131.1.34234 WP_010989131.1.34284 WP_010989131.1.34376 WP_010989131.1.34382 WP_010989131.1.34484 WP_010989131.1.34517 WP_010989131.1.34530 WP_010989131.1.34665 WP_010989131.1.34694 WP_010989131.1.34751 WP_010989131.1.34808 WP_010989131.1.34824 WP_010989131.1.34834 WP_010989131.1.34932 WP_010989131.1.34962 WP_010989131.1.35001 WP_010989131.1.35040 WP_010989131.1.35074 WP_010989131.1.35175 WP_010989131.1.35240 WP_010989131.1.35274 WP_010989131.1.35532 WP_010989131.1.35560 WP_010989131.1.3557 WP_010989131.1.35628 WP_010989131.1.3570 WP_010989131.1.35712 WP_010989131.1.35713 WP_010989131.1.35736 WP_010989131.1.35791 WP_010989131.1.35795 WP_010989131.1.35870 WP_010989131.1.35916 WP_010989131.1.35938 WP_010989131.1.35966 WP_010989131.1.36000 WP_010989131.1.36034 WP_010989131.1.36036 WP_010989131.1.36069 WP_010989131.1.36291 WP_010989131.1.36298 WP_010989131.1.36308 WP_010989131.1.36323 WP_010989131.1.36343 WP_010989131.1.3649 WP_010989131.1.36495 WP_010989131.1.36526 WP_010989131.1.36567 WP_010989131.1.36579 WP_010989131.1.36617 WP_010989131.1.36618 WP_010989131.1.36643 WP_010989131.1.36663 WP_010989131.1.36701 WP_010989131.1.36725 WP_010989131.1.36779 WP_010989131.1.36798 WP_010989131.1.36802 WP_010989131.1.36821 WP_010989131.1.36853 WP_010989131.1.36950 WP_010989131.1.37014 WP_010989131.1.37133 WP_010989131.1.37176 WP_010989131.1.37199 WP_010989131.1.37200 WP_010989131.1.37258 WP_010989131.1.37303 WP_010989131.1.37513 WP_010989131.1.37584 WP_010989131.1.37590 WP_010989131.1.37593 WP_010989131.1.37600 WP_010989131.1.37613 WP_010989131.1.37659 WP_010989131.1.37662 WP_010989131.1.37675 WP_010989131.1.37691 WP_010989131.1.37761 WP_010989131.1.37775 WP_010989131.1.37777 WP_010989131.1.378 WP_010989131.1.379 WP_010989131.1.37911 WP_010989131.1.37941 WP_010989131.1.37985 WP_010989131.1.38061 WP_010989131.1.38064 WP_010989131.1.38108 WP_010989131.1.3816 WP_010989131.1.38207 WP_010989131.1.38261 WP_010989131.1.38266 WP_010989131.1.38310 WP_010989131.1.3834 WP_010989131.1.38351 WP_010989131.1.3838 WP_010989131.1.38381 WP_010989131.1.38440 WP_010989131.1.38486 WP_010989131.1.38515 WP_010989131.1.38595 WP_010989131.1.3860 WP_010989131.1.38642 WP_010989131.1.38734 WP_010989131.1.38877 WP_010989131.1.38983 WP_010989131.1.38996 WP_010989131.1.39056 WP_010989131.1.3907 WP_010989131.1.39105 WP_010989131.1.3914 WP_010989131.1.39147 WP_010989131.1.39161 WP_010989131.1.39210 WP_010989131.1.39235 WP_010989131.1.3931 WP_010989131.1.39435 WP_010989131.1.39502 WP_010989131.1.39530 WP_010989131.1.39619 WP_010989131.1.39620 WP_010989131.1.39624 WP_010989131.1.39659 WP_010989131.1.39667 WP_010989131.1.39775 WP_010989131.1.39879 WP_010989131.1.39890 WP_010989131.1.39941 WP_010989131.1.39947 WP_010989131.1.40095 WP_010989131.1.40097 WP_010989131.1.401 WP_010989131.1.40160 WP_010989131.1.40167 WP_010989131.1.40279 WP_010989131.1.40361 WP_010989131.1.4042 WP_010989131.1.40467 WP_010989131.1.40496 WP_010989131.1.40517 WP_010989131.1.40698 WP_010989131.1.40750 WP_010989131.1.40763 WP_010989131.1.40854 WP_010989131.1.4089 WP_010989131.1.40924 WP_010989131.1.40932 WP_010989131.1.40946 WP_010989131.1.41004 WP_010989131.1.4106 WP_010989131.1.41070 WP_010989131.1.41074 WP_010989131.1.41075 WP_010989131.1.41097 WP_010989131.1.41132 WP_010989131.1.41176 WP_010989131.1.41251 WP_010989131.1.41258 WP_010989131.1.41305 WP_010989131.1.41321 WP_010989131.1.41333 WP_010989131.1.41335 WP_010989131.1.4136 WP_010989131.1.41415 WP_010989131.1.41459 WP_010989131.1.41498 WP_010989131.1.41519 WP_010989131.1.41524 WP_010989131.1.41631 WP_010989131.1.41658 WP_010989131.1.41659 WP_010989131.1.41716 WP_010989131.1.41746 WP_010989131.1.41824 WP_010989131.1.41825 WP_010989131.1.41836 WP_010989131.1.41894 WP_010989131.1.41919 WP_010989131.1.41929 WP_010989131.1.4194 WP_010989131.1.42069 WP_010989131.1.42081 WP_010989131.1.42090 WP_010989131.1.42111 WP_010989131.1.42187 WP_010989131.1.42200 WP_010989131.1.42219 WP_010989131.1.42261 WP_010989131.1.42349 WP_010989131.1.42364 WP_010989131.1.42371 WP_010989131.1.42379 WP_010989131.1.42391 WP_010989131.1.42399 WP_010989131.1.42539 WP_010989131.1.42603 WP_010989131.1.42650 WP_010989131.1.4267 WP_010989131.1.42701 WP_010989131.1.42805 WP_010989131.1.42815 WP_010989131.1.42859 WP_010989131.1.4298 WP_010989131.1.43008 WP_010989131.1.43016 WP_010989131.1.43019 WP_010989131.1.43065 WP_010989131.1.43068 WP_010989131.1.43069 WP_010989131.1.43128 WP_010989131.1.43141 WP_010989131.1.43157 WP_010989131.1.43161 WP_010989131.1.43190 WP_010989131.1.43198 WP_010989131.1.4326 WP_010989131.1.43290 WP_010989131.1.43292 WP_010989131.1.43307 WP_010989131.1.43513 WP_010989131.1.43633 WP_010989131.1.43637 WP_010989131.1.43651 WP_010989131.1.43722 WP_010989131.1.43801 WP_010989131.1.43812 WP_010989131.1.43878 WP_010989131.1.43888 WP_010989131.1.43919 WP_010989131.1.43974 WP_010989131.1.44049 WP_010989131.1.44101 WP_010989131.1.44160 WP_010989131.1.44196 WP_010989131.1.44248 WP_010989131.1.44262 WP_010989131.1.44268 WP_010989131.1.4427 WP_010989131.1.44296 WP_010989131.1.44343 WP_010989131.1.44351 WP_010989131.1.44360 WP_010989131.1.44416 WP_010989131.1.44431 WP_010989131.1.44437 WP_010989131.1.44546 WP_010989131.1.4468 WP_010989131.1.44762 WP_010989131.1.44815 WP_010989131.1.44828 WP_010989131.1.44879 WP_010989131.1.44917 WP_010989131.1.4501 WP_010989131.1.45072 WP_010989131.1.45093 WP_010989131.1.45136 WP_010989131.1.45241 WP_010989131.1.45435 WP_010989131.1.45523 WP_010989131.1.45596 WP_010989131.1.45648 WP_010989131.1.45829 WP_010989131.1.45871 WP_010989131.1.46030 WP_010989131.1.46077 WP_010989131.1.46169 WP_010989131.1.46225 WP_010989131.1.46241 WP_010989131.1.46307 WP_010989131.1.46355 WP_010989131.1.464 WP_010989131.1.46454 WP_010989131.1.46461 WP_010989131.1.46504 WP_010989131.1.46505 WP_010989131.1.46551 WP_010989131.1.46559 WP_010989131.1.46701 WP_010989131.1.46781 WP_010989131.1.46816 WP_010989131.1.46842 WP_010989131.1.4690 WP_010989131.1.46920 WP_010989131.1.46945 WP_010989131.1.47036 WP_010989131.1.47037 WP_010989131.1.47042 WP_010989131.1.47059 WP_010989131.1.47085 WP_010989131.1.47123 WP_010989131.1.47215 WP_010989131.1.47245 WP_010989131.1.47523 WP_010989131.1.47531 WP_010989131.1.47532 WP_010989131.1.47605 WP_010989131.1.47630 WP_010989131.1.4774 WP_010989131.1.47756 WP_010989131.1.4781 WP_010989131.1.47886 WP_010989131.1.47898 WP_010989131.1.48019 WP_010989131.1.48100 WP_010989131.1.48114 WP_010989131.1.48139 WP_010989131.1.48190 WP_010989131.1.48292 WP_010989131.1.48324 WP_010989131.1.48426 WP_010989131.1.48430 WP_010989131.1.48436 WP_010989131.1.48586 WP_010989131.1.4859 WP_010989131.1.48591 WP_010989131.1.48610 WP_010989131.1.48631 WP_010989131.1.48663 WP_010989131.1.48690 WP_010989131.1.48734 WP_010989131.1.48756 WP_010989131.1.48778 WP_010989131.1.48849 WP_010989131.1.48955 WP_010989131.1.48963 WP_010989131.1.48973 WP_010989131.1.49004 WP_010989131.1.49106 WP_010989131.1.49117 WP_010989131.1.49121 WP_010989131.1.4914 WP_010989131.1.49140 WP_010989131.1.49153 WP_010989131.1.49166 WP_010989131.1.49355 WP_010989131.1.49429 WP_010989131.1.49434 WP_010989131.1.49450 WP_010989131.1.495 WP_010989131.1.49545 WP_010989131.1.49703 WP_010989131.1.49769 WP_010989131.1.49846 WP_010989131.1.4991 WP_010989131.1.49947 WP_010989131.1.49959 WP_010989131.1.49997 WP_010989131.1.50014 WP_010989131.1.50030 WP_010989131.1.50043 WP_010989131.1.50103 WP_010989131.1.50158 WP_010989131.1.50247 WP_010989131.1.50308 WP_010989131.1.50309 WP_010989131.1.50387 WP_010989131.1.50406 WP_010989131.1.50468 WP_010989131.1.5051 WP_010989131.1.50566 WP_010989131.1.50570 WP_010989131.1.50626 WP_010989131.1.50726 WP_010989131.1.50771 WP_010989131.1.50875 WP_010989131.1.50885 WP_010989131.1.509 WP_010989131.1.50929 WP_010989131.1.50970 WP_010989131.1.51040 WP_010989131.1.51048 WP_010989131.1.51100 WP_010989131.1.51134 WP_010989131.1.5127 WP_010989131.1.51305 WP_010989131.1.51315 WP_010989131.1.5136 WP_010989131.1.51474 WP_010989131.1.51519 WP_010989131.1.51598 WP_010989131.1.51644 WP_010989131.1.51724 WP_010989131.1.51734 WP_010989131.1.51838 WP_010989131.1.51863 WP_010989131.1.51935 WP_010989131.1.52057 WP_010989131.1.52114 WP_010989131.1.52129 WP_010989131.1.52191 WP_010989131.1.52202 WP_010989131.1.52209 WP_010989131.1.52339 WP_010989131.1.52469 WP_010989131.1.52571 WP_010989131.1.526 WP_010989131.1.52647 WP_010989131.1.52742 WP_010989131.1.52773 WP_010989131.1.52795 WP_010989131.1.52807 WP_010989131.1.52887 WP_010989131.1.53092 WP_010989131.1.53141 WP_010989131.1.53151 WP_010989131.1.53154 WP_010989131.1.53159 WP_010989131.1.53210 WP_010989131.1.53233 WP_010989131.1.53307 WP_010989131.1.53321 WP_010989131.1.53368 WP_010989131.1.53375 WP_010989131.1.53450 WP_010989131.1.5349 WP_010989131.1.53540 WP_010989131.1.53555 WP_010989131.1.53559 WP_010989131.1.5356 WP_010989131.1.53571 WP_010989131.1.5358 WP_010989131.1.53692 WP_010989131.1.53723 WP_010989131.1.5374 WP_010989131.1.53750 WP_010989131.1.53800 WP_010989131.1.53815 WP_010989131.1.53839 WP_010989131.1.53892 WP_010989131.1.53898 WP_010989131.1.53902 WP_010989131.1.53958 WP_010989131.1.53981 WP_010989131.1.53984 WP_010989131.1.54132 WP_010989131.1.54170 WP_010989131.1.54175 WP_010989131.1.54203 WP_010989131.1.54259 WP_010989131.1.5430 WP_010989131.1.54371 WP_010989131.1.54431 WP_010989131.1.54442 WP_010989131.1.54482 WP_010989131.1.54589 WP_010989131.1.54667 WP_010989131.1.54678 WP_010989131.1.54681 WP_010989131.1.54748 WP_010989131.1.5481 WP_010989131.1.54865 WP_010989131.1.54935 WP_010989131.1.54979 WP_010989131.1.55010 WP_010989131.1.55034 WP_010989131.1.55163 WP_010989131.1.55165 WP_010989131.1.55215 WP_010989131.1.55290 WP_010989131.1.55310 WP_010989131.1.55317 WP_010989131.1.55379 WP_010989131.1.5539 WP_010989131.1.55468 WP_010989131.1.55506 WP_010989131.1.55604 WP_010989131.1.55639 WP_010989131.1.55699 WP_010989131.1.55725 WP_010989131.1.55780 WP_010989131.1.55967 WP_010989131.1.56144 WP_010989131.1.56172 WP_010989131.1.5621 WP_010989131.1.56226 WP_010989131.1.56311 WP_010989131.1.56419 WP_010989131.1.56423 WP_010989131.1.56514 WP_010989131.1.56535 WP_010989131.1.56585 WP_010989131.1.56640 WP_010989131.1.56724 WP_010989131.1.56825 WP_010989131.1.56887 WP_010989131.1.56889 WP_010989131.1.56981 WP_010989131.1.57101 WP_010989131.1.57137 WP_010989131.1.57147 WP_010989131.1.57179 WP_010989131.1.57186 WP_010989131.1.57342 WP_010989131.1.57684 WP_010989131.1.57699 WP_010989131.1.57785 WP_010989131.1.57800 WP_010989131.1.57873 WP_010989131.1.57965 WP_010989131.1.57972 WP_010989131.1.58008 WP_010989131.1.58044 WP_010989131.1.58081 WP_010989131.1.5809 WP_010989131.1.58132 WP_010989131.1.58173 WP_010989131.1.58191 WP_010989131.1.58194 WP_010989131.1.58252 WP_010989131.1.58261 WP_010989131.1.58274 WP_010989131.1.58282 WP_010989131.1.58324 WP_010989131.1.58326 WP_010989131.1.5836 WP_010989131.1.58485 WP_010989131.1.58537 WP_010989131.1.58568 WP_010989131.1.58583 WP_010989131.1.58652 WP_010989131.1.58663 WP_010989131.1.58724 WP_010989131.1.5875 WP_010989131.1.58796 WP_010989131.1.58807 WP_010989131.1.58847 WP_010989131.1.58883 WP_010989131.1.58898 WP_010989131.1.58949 WP_010989131.1.58963 WP_010989131.1.58970 WP_010989131.1.58974 WP_010989131.1.59020 WP_010989131.1.59043 WP_010989131.1.59056 WP_010989131.1.59061 WP_010989131.1.59064 WP_010989131.1.59282 WP_010989131.1.59299 WP_010989131.1.59313 WP_010989131.1.5949 WP_010989131.1.59501 WP_010989131.1.59510 WP_010989131.1.5969 WP_010989131.1.59751 WP_010989131.1.59827 WP_010989131.1.59829 WP_010989131.1.59847 WP_010989131.1.59863 WP_010989131.1.59969 WP_010989131.1.59994 WP_010989131.1.60045 WP_010989131.1.60076 WP_010989131.1.60114 WP_010989131.1.60154 WP_010989131.1.60168 WP_010989131.1.60192 WP_010989131.1.60199 WP_010989131.1.60212 WP_010989131.1.60253 WP_010989131.1.60322 WP_010989131.1.60324 WP_010989131.1.60356 WP_010989131.1.6038 WP_010989131.1.60380 WP_010989131.1.6041 WP_010989131.1.60424 WP_010989131.1.60481 WP_010989131.1.605 WP_010989131.1.6058 WP_010989131.1.60584 WP_010989131.1.6060 WP_010989131.1.60676 WP_010989131.1.60708 WP_010989131.1.60725 WP_010989131.1.60783 WP_010989131.1.60792 WP_010989131.1.60807 WP_010989131.1.60882 WP_010989131.1.60889 WP_010989131.1.60950 WP_010989131.1.6104 WP_010989131.1.61044 WP_010989131.1.61076 WP_010989131.1.61123 WP_010989131.1.61147 WP_010989131.1.61168 WP_010989131.1.61210 WP_010989131.1.61357 WP_010989131.1.61511 WP_010989131.1.61539 WP_010989131.1.61542 WP_010989131.1.61553 WP_010989131.1.61649 WP_010989131.1.61652 WP_010989131.1.61697 WP_010989131.1.61809 WP_010989131.1.61877 WP_010989131.1.61920 WP_010989131.1.62124 WP_010989131.1.62199 WP_010989131.1.62223 WP_010989131.1.62302 WP_010989131.1.62314 WP_010989131.1.62323 WP_010989131.1.62333 WP_010989131.1.62338 WP_010989131.1.62380 WP_010989131.1.62411 WP_010989131.1.62436 WP_010989131.1.62475 WP_010989131.1.62536 WP_010989131.1.62640 WP_010989131.1.62686 WP_010989131.1.62751 WP_010989131.1.62825 WP_010989131.1.62913 WP_010989131.1.62932 WP_010989131.1.62960 WP_010989131.1.63016 WP_010989131.1.63025 WP_010989131.1.63069 WP_010989131.1.63087 WP_010989131.1.63169 WP_010989131.1.63297 WP_010989131.1.63448 WP_010989131.1.63514 WP_010989131.1.63583 WP_010989131.1.63592 WP_010989131.1.63663 WP_010989131.1.63736 WP_010989131.1.63816 WP_010989131.1.63876 WP_010989131.1.6389 WP_010989131.1.63901 WP_010989131.1.63955 WP_010989131.1.63963 WP_010989131.1.64032 WP_010989131.1.64087 WP_010989131.1.6415 WP_010989131.1.64293 WP_010989131.1.64332 WP_010989131.1.64376 WP_010989131.1.644 WP_010989131.1.64471 WP_010989131.1.64501 WP_010989131.1.64538 WP_010989131.1.64632 WP_010989131.1.64648 WP_010989131.1.64654 WP_010989131.1.64662 WP_010989131.1.64663 WP_010989131.1.64710 WP_010989131.1.64744 WP_010989131.1.64763 WP_010989131.1.64817 WP_010989131.1.64847 WP_010989131.1.6487 WP_010989131.1.64891 WP_010989131.1.64974 WP_010989131.1.65054 WP_010989131.1.65075 WP_010989131.1.6514 WP_010989131.1.65172 WP_010989131.1.65191 WP_010989131.1.65200 WP_010989131.1.65211 WP_010989131.1.65218 WP_010989131.1.65226 WP_010989131.1.65249 WP_010989131.1.65266 WP_010989131.1.65395 WP_010989131.1.65459 WP_010989131.1.65463 WP_010989131.1.65487 WP_010989131.1.6549 WP_010989131.1.65499 WP_010989131.1.6554 WP_010989131.1.65650 WP_010989131.1.65697 WP_010989131.1.65699 WP_010989131.1.65737 WP_010989131.1.65755 WP_010989131.1.65812 WP_010989131.1.65846 WP_010989131.1.65863 WP_010989131.1.65985 WP_010989131.1.66021 WP_010989131.1.66031 WP_010989131.1.66052 WP_010989131.1.66064 WP_010989131.1.66109 WP_010989131.1.66145 WP_010989131.1.66183 WP_010989131.1.6620 WP_010989131.1.66216 WP_010989131.1.66234 WP_010989131.1.66273 WP_010989131.1.66324 WP_010989131.1.6634 WP_010989131.1.66361 WP_010989131.1.66480 WP_010989131.1.66506 WP_010989131.1.66665 WP_010989131.1.66681 WP_010989131.1.66684 WP_010989131.1.66755 WP_010989131.1.66759 WP_010989131.1.66801 WP_010989131.1.66860 WP_010989131.1.66953 WP_010989131.1.66955 WP_010989131.1.66981 WP_010989131.1.67024 WP_010989131.1.67042 WP_010989131.1.67101 WP_010989131.1.67143 WP_010989131.1.67201 WP_010989131.1.67211 WP_010989131.1.67237 WP_010989131.1.67336 WP_010989131.1.67339 WP_010989131.1.67387 WP_010989131.1.67394 WP_010989131.1.67397 WP_010989131.1.67403 WP_010989131.1.67430 WP_010989131.1.67442 WP_010989131.1.67539 WP_010989131.1.67556 WP_010989131.1.67576 WP_010989131.1.67604 WP_010989131.1.67619 WP_010989131.1.67625 WP_010989131.1.67627 WP_010989131.1.67641 WP_010989131.1.67657 WP_010989131.1.67673 WP_010989131.1.67700 WP_010989131.1.67718 WP_010989131.1.67729 WP_010989131.1.67774 WP_010989131.1.67820 WP_010989131.1.67910 WP_010989131.1.67954 WP_010989131.1.68 WP_010989131.1.68043 WP_010989131.1.68105 WP_010989131.1.68113 WP_010989131.1.68131 WP_010989131.1.68182 WP_010989131.1.6819 WP_010989131.1.68285 WP_010989131.1.68359 WP_010989131.1.68420 WP_010989131.1.68514 WP_010989131.1.68564 WP_010989131.1.68688 WP_010989131.1.68742 WP_010989131.1.68770 WP_010989131.1.68809 WP_010989131.1.68914 WP_010989131.1.69053 WP_010989131.1.69170 WP_010989131.1.69210 WP_010989131.1.69270 WP_010989131.1.69282 WP_010989131.1.69376 WP_010989131.1.69396 WP_010989131.1.69466 WP_010989131.1.69611 WP_010989131.1.69642 WP_010989131.1.69656 WP_010989131.1.69657 WP_010989131.1.69690 WP_010989131.1.69923 WP_010989131.1.69948 WP_010989131.1.69953 WP_010989131.1.70010 WP_010989131.1.70049 WP_010989131.1.70058 WP_010989131.1.70061 WP_010989131.1.70205 WP_010989131.1.70240 WP_010989131.1.70249 WP_010989131.1.70261 WP_010989131.1.70314 WP_010989131.1.7033 WP_010989131.1.70427 WP_010989131.1.70433 WP_010989131.1.70545 WP_010989131.1.70623 WP_010989131.1.70671 WP_010989131.1.70679 WP_010989131.1.70708 WP_010989131.1.70717 WP_010989131.1.70731 WP_010989131.1.70772 WP_010989131.1.70845 WP_010989131.1.70846 WP_010989131.1.70981 WP_010989131.1.70995 WP_010989131.1.71039 WP_010989131.1.71057 WP_010989131.1.71081 WP_010989131.1.71117 WP_010989131.1.71186 WP_010989131.1.71455 WP_010989131.1.71456 WP_010989131.1.71487 WP_010989131.1.71523 WP_010989131.1.71542 WP_010989131.1.71566 WP_010989131.1.71640 WP_010989131.1.71651 WP_010989131.1.71653 WP_010989131.1.71716 WP_010989131.1.71872 WP_010989131.1.71950 WP_010989131.1.71954 WP_010989131.1.71985 WP_010989131.1.72003 WP_010989131.1.72073 WP_010989131.1.72269 WP_010989131.1.72350 WP_010989131.1.72383 WP_010989131.1.72461 WP_010989131.1.72527 WP_010989131.1.7255 WP_010989131.1.72631 WP_010989131.1.72638 WP_010989131.1.72667 WP_010989131.1.72674 WP_010989131.1.72724 WP_010989131.1.72789 WP_010989131.1.72896 WP_010989131.1.72969 WP_010989131.1.72987 WP_010989131.1.73052 WP_010989131.1.7311 WP_010989131.1.73114 WP_010989131.1.73177 WP_010989131.1.73180 WP_010989131.1.73258 WP_010989131.1.73285 WP_010989131.1.7332 WP_010989131.1.7333 WP_010989131.1.73352 WP_010989131.1.73389 WP_010989131.1.73425 WP_010989131.1.73488 WP_010989131.1.73504 WP_010989131.1.7353 WP_010989131.1.73544 WP_010989131.1.73598 WP_010989131.1.7361 WP_010989131.1.73648 WP_010989131.1.73768 WP_010989131.1.73849 WP_010989131.1.73948 WP_010989131.1.73999 WP_010989131.1.74024 WP_010989131.1.74030 WP_010989131.1.74038 WP_010989131.1.74043 WP_010989131.1.74058 WP_010989131.1.74070 WP_010989131.1.74077 WP_010989131.1.74135 WP_010989131.1.74214 WP_010989131.1.74241 WP_010989131.1.74285 WP_010989131.1.7430 WP_010989131.1.74317 WP_010989131.1.74415 WP_010989131.1.74616 WP_010989131.1.74621 WP_010989131.1.74647 WP_010989131.1.74677 WP_010989131.1.74699 WP_010989131.1.74831 WP_010989131.1.74894 WP_010989131.1.74929 WP_010989131.1.74939 WP_010989131.1.74973 WP_010989131.1.7507 WP_010989131.1.75089 WP_010989131.1.75116 WP_010989131.1.75237 WP_010989131.1.75273 WP_010989131.1.75296 WP_010989131.1.75413 WP_010989131.1.75433 WP_010989131.1.75532 WP_010989131.1.75565 WP_010989131.1.75593 WP_010989131.1.75610 WP_010989131.1.75633 WP_010989131.1.75718 WP_010989131.1.75745 WP_010989131.1.75844 WP_010989131.1.75886 WP_010989131.1.75898 WP_010989131.1.76081 WP_010989131.1.76116 WP_010989131.1.76122 WP_010989131.1.76256 WP_010989131.1.76339 WP_010989131.1.76366 WP_010989131.1.76417 WP_010989131.1.7646 WP_010989131.1.76510 WP_010989131.1.76558 WP_010989131.1.76572 WP_010989131.1.76641 WP_010989131.1.76651 WP_010989131.1.76653 WP_010989131.1.76788 WP_010989131.1.76854 WP_010989131.1.76916 WP_010989131.1.76932 WP_010989131.1.76973 WP_010989131.1.76988 WP_010989131.1.77016 WP_010989131.1.77087 WP_010989131.1.77090 WP_010989131.1.77111 WP_010989131.1.77299 WP_010989131.1.77384 WP_010989131.1.77501 WP_010989131.1.77512 WP_010989131.1.77513 WP_010989131.1.77563 WP_010989131.1.77702 WP_010989131.1.77713 WP_010989131.1.7772 WP_010989131.1.77825 WP_010989131.1.77837 WP_010989131.1.77900 WP_010989131.1.77923 WP_010989131.1.77975 WP_010989131.1.78035 WP_010989131.1.78048 WP_010989131.1.78107 WP_010989131.1.78166 WP_010989131.1.78192 WP_010989131.1.78195 WP_010989131.1.78291 WP_010989131.1.78309 WP_010989131.1.78320 WP_010989131.1.78382 WP_010989131.1.78388 WP_010989131.1.78410 WP_010989131.1.7862 WP_010989131.1.78626 WP_010989131.1.78661 WP_010989131.1.78674 WP_010989131.1.78676 WP_010989131.1.78761 WP_010989131.1.789 WP_010989131.1.78993 WP_010989131.1.79012 WP_010989131.1.79069 WP_010989131.1.79074 WP_010989131.1.79098 WP_010989131.1.79155 WP_010989131.1.79164 WP_010989131.1.79204 WP_010989131.1.79280 WP_010989131.1.79397 WP_010989131.1.79456 WP_010989131.1.79532 WP_010989131.1.79547 WP_010989131.1.79654 WP_010989131.1.7970 WP_010989131.1.79722 WP_010989131.1.79772 WP_010989131.1.79880 WP_010989131.1.79916 WP_010989131.1.80065 WP_010989131.1.80103 WP_010989131.1.80273 WP_010989131.1.80282 WP_010989131.1.80354 WP_010989131.1.80368 WP_010989131.1.80386 WP_010989131.1.80400 WP_010989131.1.80462 WP_010989131.1.8049 WP_010989131.1.80492 WP_010989131.1.80569 WP_010989131.1.80664 WP_010989131.1.80696 WP_010989131.1.80984 WP_010989131.1.81131 WP_010989131.1.81187 WP_010989131.1.81262 WP_010989131.1.81268 WP_010989131.1.81269 WP_010989131.1.81271 WP_010989131.1.8131 WP_010989131.1.81333 WP_010989131.1.81342 WP_010989131.1.81364 WP_010989131.1.81494 WP_010989131.1.81557 WP_010989131.1.81676 WP_010989131.1.81681 WP_010989131.1.8170 WP_010989131.1.81763 WP_010989131.1.81855 WP_010989131.1.81921 WP_010989131.1.81931 WP_010989131.1.81936 WP_010989131.1.81949 WP_010989131.1.82070 WP_010989131.1.82076 WP_010989131.1.82131 WP_010989131.1.82156 WP_010989131.1.8218 WP_010989131.1.82180 WP_010989131.1.82201 WP_010989131.1.82214 WP_010989131.1.82225 WP_010989131.1.8240 WP_010989131.1.82408 WP_010989131.1.82416 WP_010989131.1.8242 WP_010989131.1.82456 WP_010989131.1.82465 WP_010989131.1.82473 WP_010989131.1.82553 WP_010989131.1.82646 WP_010989131.1.82670 WP_010989131.1.82731 WP_010989131.1.82812 WP_010989131.1.82850 WP_010989131.1.82872 WP_010989131.1.8294 WP_010989131.1.82959 WP_010989131.1.83007 WP_010989131.1.8304 WP_010989131.1.83180 WP_010989131.1.83229 WP_010989131.1.83235 WP_010989131.1.83290 WP_010989131.1.83333 WP_010989131.1.83657 WP_010989131.1.83677 WP_010989131.1.8375 WP_010989131.1.83923 WP_010989131.1.83994 WP_010989131.1.84 WP_010989131.1.8406 WP_010989131.1.84076 WP_010989131.1.84110 WP_010989131.1.84127 WP_010989131.1.84150 WP_010989131.1.84230 WP_010989131.1.84252 WP_010989131.1.8431 WP_010989131.1.84345 WP_010989131.1.84369 WP_010989131.1.84401 WP_010989131.1.84435 WP_010989131.1.84567 WP_010989131.1.84631 WP_010989131.1.84727 WP_010989131.1.84744 WP_010989131.1.84773 WP_010989131.1.84945 WP_010989131.1.84967 WP_010989131.1.85004 WP_010989131.1.8502 WP_010989131.1.85039 WP_010989131.1.85153 WP_010989131.1.85273 WP_010989131.1.85338 WP_010989131.1.85339 WP_010989131.1.85511 WP_010989131.1.8557 WP_010989131.1.85606 WP_010989131.1.85635 WP_010989131.1.85646 WP_010989131.1.85665 WP_010989131.1.85669 WP_010989131.1.85688 WP_010989131.1.85703 WP_010989131.1.85728 WP_010989131.1.85746 WP_010989131.1.85811 WP_010989131.1.859 WP_010989131.1.85917 WP_010989131.1.8594 WP_010989131.1.85977 WP_010989131.1.860 WP_010989131.1.8605 WP_010989131.1.86084 WP_010989131.1.8610 WP_010989131.1.8614 WP_010989131.1.86156 WP_010989131.1.86323 WP_010989131.1.86342 WP_010989131.1.8640 WP_010989131.1.8642 WP_010989131.1.86426 WP_010989131.1.86489 WP_010989131.1.86530 WP_010989131.1.86663 WP_010989131.1.86770 WP_010989131.1.86794 WP_010989131.1.86800 WP_010989131.1.86811 WP_010989131.1.86815 WP_010989131.1.86945 WP_010989131.1.86989 WP_010989131.1.87023 WP_010989131.1.87034 WP_010989131.1.87041 WP_010989131.1.87136 WP_010989131.1.87155 WP_010989131.1.87258 WP_010989131.1.87293 WP_010989131.1.87420 WP_010989131.1.87528 WP_010989131.1.87560 WP_010989131.1.8760 WP_010989131.1.87600 WP_010989131.1.87609 WP_010989131.1.87612 WP_010989131.1.87615 WP_010989131.1.87653 WP_010989131.1.87659 WP_010989131.1.87698 WP_010989131.1.87706 WP_010989131.1.87739 WP_010989131.1.87741 WP_010989131.1.87742 WP_010989131.1.87852 WP_010989131.1.87949 WP_010989131.1.88025 WP_010989131.1.88026 WP_010989131.1.8805 WP_010989131.1.8806 WP_010989131.1.881 WP_010989131.1.88145 WP_010989131.1.88199 WP_010989131.1.88299 WP_010989131.1.88313 WP_010989131.1.88359 WP_010989131.1.88407 WP_010989131.1.88414 WP_010989131.1.88444 WP_010989131.1.88446 WP_010989131.1.88458 WP_010989131.1.88501 WP_010989131.1.88538 WP_010989131.1.88547 WP_010989131.1.886 WP_010989131.1.88647 WP_010989131.1.88648 WP_010989131.1.88692 WP_010989131.1.88707 WP_010989131.1.88727 WP_010989131.1.88772 WP_010989131.1.88850 WP_010989131.1.8889 WP_010989131.1.88892 WP_010989131.1.88894 WP_010989131.1.89182 WP_010989131.1.89298 WP_010989131.1.89308 WP_010989131.1.89314 WP_010989131.1.89328 WP_010989131.1.89332 WP_010989131.1.89343 WP_010989131.1.89395 WP_010989131.1.8940 WP_010989131.1.89449 WP_010989131.1.8947 WP_010989131.1.89503 WP_010989131.1.89591 WP_010989131.1.89668 WP_010989131.1.89706 WP_010989131.1.89713 WP_010989131.1.89733 WP_010989131.1.89796 WP_010989131.1.89804 WP_010989131.1.89845 WP_010989131.1.89888 WP_010989131.1.89911 WP_010989131.1.8995 WP_010989131.1.89952 WP_010989131.1.90007 WP_010989131.1.9011 WP_010989131.1.90196 WP_010989131.1.90240 WP_010989131.1.90274 WP_010989131.1.90280 WP_010989131.1.90330 WP_010989131.1.90338 WP_010989131.1.90365 WP_010989131.1.90428 WP_010989131.1.90489 WP_010989131.1.90513 WP_010989131.1.90582 WP_010989131.1.90713 WP_010989131.1.90794 WP_010989131.1.90796 WP_010989131.1.90811 WP_010989131.1.9091 WP_010989131.1.91067 WP_010989131.1.91164 WP_010989131.1.91205 WP_010989131.1.91239 WP_010989131.1.91291 WP_010989131.1.91313 WP_010989131.1.9135 WP_010989131.1.91506 WP_010989131.1.91557 WP_010989131.1.91597 WP_010989131.1.91715 WP_010989131.1.9187 WP_010989131.1.91870 WP_010989131.1.92018 WP_010989131.1.92087 WP_010989131.1.92098 WP_010989131.1.92156 WP_010989131.1.92172 WP_010989131.1.92240 WP_010989131.1.92243 WP_010989131.1.92327 WP_010989131.1.92470 WP_010989131.1.92477 WP_010989131.1.92545 WP_010989131.1.92570 WP_010989131.1.92588 WP_010989131.1.926 WP_010989131.1.92633 WP_010989131.1.92649 WP_010989131.1.92676 WP_010989131.1.92705 WP_010989131.1.9271 WP_010989131.1.92734 WP_010989131.1.92810 WP_010989131.1.92823 WP_010989131.1.92987 WP_010989131.1.93007 WP_010989131.1.93022 WP_010989131.1.93103 WP_010989131.1.93105 WP_010989131.1.93111 WP_010989131.1.93121 WP_010989131.1.93168 WP_010989131.1.93184 WP_010989131.1.93221 WP_010989131.1.93223 WP_010989131.1.93239 WP_010989131.1.93302 WP_010989131.1.9336 WP_010989131.1.93387 WP_010989131.1.93469 WP_010989131.1.93511 WP_010989131.1.93512 WP_010989131.1.93635 WP_010989131.1.93657 WP_010989131.1.9374 WP_010989131.1.9375 WP_010989131.1.93754 WP_010989131.1.93780 WP_010989131.1.93828 WP_010989131.1.93842 WP_010989131.1.93843 WP_010989131.1.93875 WP_010989131.1.93909 WP_010989131.1.93919 WP_010989131.1.93938 WP_010989131.1.93984 WP_010989131.1.9399 WP_010989131.1.94017 WP_010989131.1.94079 WP_010989131.1.94097 WP_010989131.1.94107 WP_010989131.1.94142 WP_010989131.1.94215 WP_010989131.1.94303 WP_010989131.1.94365 WP_010989131.1.94390 WP_010989131.1.94415 WP_010989131.1.94510 WP_010989131.1.94527 WP_010989131.1.94573 WP_010989131.1.94579 WP_010989131.1.94586 WP_010989131.1.94593 WP_010989131.1.94650 WP_010989131.1.94659 WP_010989131.1.94662 WP_010989131.1.94700 WP_010989131.1.94745 WP_010989131.1.94782 WP_010989131.1.94815 WP_010989131.1.94820 WP_010989131.1.94850 WP_010989131.1.94851 WP_010989131.1.94864 WP_010989131.1.94952 WP_010989131.1.95006 WP_010989131.1.95055 WP_010989131.1.95076 WP_010989131.1.95099 WP_010989131.1.95165 WP_010989131.1.95239 WP_010989131.1.95246 WP_010989131.1.9525 WP_010989131.1.95255 WP_010989131.1.95265 WP_010989131.1.95338 WP_010989131.1.95412 WP_010989131.1.95530 WP_010989131.1.95547 WP_010989131.1.95590 WP_010989131.1.95625 WP_010989131.1.95675 WP_010989131.1.95716 WP_010989131.1.95776 WP_010989131.1.95884 WP_010989131.1.95890 WP_010989131.1.95906 WP_010989131.1.96025 WP_010989131.1.96044 WP_010989131.1.96054 WP_010989131.1.96094 WP_010989131.1.96127 WP_010989131.1.96144 WP_010989131.1.96188 WP_010989131.1.96211 WP_010989131.1.96212 WP_010989131.1.96319 WP_010989131.1.9633 WP_010989131.1.96359 WP_010989131.1.96539 WP_010989131.1.96552 WP_010989131.1.96610 WP_010989131.1.96625 WP_010989131.1.96635 WP_010989131.1.9664 WP_010989131.1.96675 WP_010989131.1.9670 WP_010989131.1.96750 WP_010989131.1.96792 WP_010989131.1.96801 WP_010989131.1.96803 WP_010989131.1.96925 WP_010989131.1.96938 WP_010989131.1.96946 WP_010989131.1.96957 WP_010989131.1.96978 WP_010989131.1.97026 WP_010989131.1.97028 WP_010989131.1.97079 WP_010989131.1.97154 WP_010989131.1.97184 WP_010989131.1.97287 WP_010989131.1.97291 WP_010989131.1.97422 WP_010989131.1.97441 WP_010989131.1.97497 WP_010989131.1.97505 WP_010989131.1.97599 WP_010989131.1.97606 WP_010989131.1.97615 WP_010989131.1.97646 WP_010989131.1.97690 WP_010989131.1.97819 WP_010989131.1.97840 WP_010989131.1.97938 WP_010989131.1.97986 WP_010989131.1.98036 WP_010989131.1.98080 WP_010989131.1.98086 WP_010989131.1.98158 WP_010989131.1.98263 WP_010989131.1.98418 WP_010989131.1.98448 WP_010989131.1.98457 WP_010989131.1.9850 WP_010989131.1.98502 WP_010989131.1.98607 WP_010989131.1.98731 WP_010989131.1.98762 WP_010989131.1.9877 WP_010989131.1.98801 WP_010989131.1.98818 WP_010989131.1.99163 WP_010989131.1.99335 WP_010989131.1.99350 WP_010989131.1.99360 WP_010989131.1.99363 WP_010989131.1.99369 WP_010989131.1.99388 WP_010989131.1.99397 WP_010989131.1.99463 WP_010989131.1.99483 WP_010989131.1.99546 WP_010989131.1.99579 WP_010989131.1.99595 WP_010989131.1.99671 WP_010989131.1.99676 WP_010989131.1.99764 WP_010989131.1.99829 WP_010989131.1.99837 WP_010989131.1.99841 WP_010989131.1.9992 WP_010989131.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]