SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759847|ref|NP_455464.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759847|ref|NP_455464.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.79e-114
Family GABA-aminotransferase-like 0.0000000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16759847|ref|NP_455464.1|
Sequence length 362
Comment phosphoserine aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MAQVFNFSSGPAMLPAEVLKLAQQELRDWHGLGTSVMEISHRGKEFIQVAEEAEQDFRDL
LNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKTTADYVDAGYWAASAIKEAKKYCAPQIID
AKITVDGKRAVKPMREWQLSDNAAYLHYCPNETIDGIAIDETPDFGPEVVVTADFSSTIL
SAPLDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHESCPSILDYTVLNDNDSMFNT
PPTFAWYLSGLVFKWLKAQGGVAAMHKINQQKAELLYGVIDNSDFYRNDVAQANRSRMNV
PFQLADNALDKVFLEESFAAGLHALKGHRVVGGMRASIYNAMPIEGVKALTDFMIDFERR
HG
Download sequence
Identical sequences A0A0F5BCW3 A0A0G2NLZ0 A0A0M0QX51 A0A0V2DGJ0 A0A0V2F3V1 A0A1C2ZTT3 A0A1J4QYU6 A0A1R2WX54 A0A1S0ZCK7 A0A1X2UU79 A0A221Z1R9 A0A265B998 A0A267SES2 A0A271CD10 A0A271CZ97 A0A2C6FYZ3 A0A2D1Y791 A0A2G1NUC5 A0A2I6MAC8 A0A2I6N128 A0A2I6NF49 A0A2I6P602 A0A2K2YJT7 A9N7V7 B4TD37 B4TRT8 B5F159 B5FQ49 B5QYQ7 B5R8J4 G4C0D1 G5L768 G5Q0J9 G5QGU2 G5RDI9 M7RQZ6 P62676 P62677 S4HKB2 V1XAM9 V7UTP2
gi|378955700|ref|YP_005213187.1| ABAM02000001|CDS_1516732-1517820 ABEJ01000007|CDS_184801-185889 ABEL01000001|CDS_761101-762189 ABFF01000028|CDS_4761-3673 ABFG01000010|CDS_19021-17933 AE014613|CDS_2009091-2008003 AL513382|CDS_971986-973074 AM933172|CDS_976630-977718 AM933173|CDS_994460-995548 CP000886|CDS_2100729-2099641 CP001120|CDS_1065864-1066952 CP001127|CDS_1069981-1071069 CP001138|CDS_976859-977947 CP001144|CDS_1041448-1042536 NZ_ACBF01000022|CDS_46806-45718 gi|207856368|ref|YP_002243019.1| gi|198245493|ref|YP_002214900.1| gi|409249386|ref|YP_006885216.1| gi|194734606|ref|YP_002114028.1| gi|537437267|ref|YP_008481644.1| gi|488654471|ref|YP_007926274.1| gi|386590842|ref|YP_006087242.1| gi|16759847|ref|NP_455464.1| gi|525816858|ref|YP_008246876.1| gi|378960122|ref|YP_005217608.1| gi|205352184|ref|YP_002225985.1| gi|194448926|ref|YP_002044969.1| gi|161614787|ref|YP_001588752.1| 209261.t1957 220341.STY0977 272994.SPAB_02539 439843.SeSA_A1090 439851.SeD_A1041 454166.SeAg_B0982 454169.SeHA_C1075 550537.SEN0881 550538.SG0919 gi|563652466|ref|YP_008860527.1| gi|197247869|ref|YP_002145894.1| NP_455464.1.84458 WP_000079590.1.100007 WP_000079590.1.100008 WP_000079590.1.100017 WP_000079590.1.100031 WP_000079590.1.100036 WP_000079590.1.100077 WP_000079590.1.100079 WP_000079590.1.10013 WP_000079590.1.100149 WP_000079590.1.100165 WP_000079590.1.100191 WP_000079590.1.100196 WP_000079590.1.1002 WP_000079590.1.100258 WP_000079590.1.100266 WP_000079590.1.100284 WP_000079590.1.100288 WP_000079590.1.100313 WP_000079590.1.100314 WP_000079590.1.100321 WP_000079590.1.100354 WP_000079590.1.100392 WP_000079590.1.100412 WP_000079590.1.100413 WP_000079590.1.100421 WP_000079590.1.100432 WP_000079590.1.100438 WP_000079590.1.100446 WP_000079590.1.100450 WP_000079590.1.100457 WP_000079590.1.100519 WP_000079590.1.100541 WP_000079590.1.100557 WP_000079590.1.100589 WP_000079590.1.100592 WP_000079590.1.100605 WP_000079590.1.100610 WP_000079590.1.10065 WP_000079590.1.100714 WP_000079590.1.100721 WP_000079590.1.100730 WP_000079590.1.100732 WP_000079590.1.100733 WP_000079590.1.100739 WP_000079590.1.100764 WP_000079590.1.100773 WP_000079590.1.100776 WP_000079590.1.100790 WP_000079590.1.100799 WP_000079590.1.10081 WP_000079590.1.100857 WP_000079590.1.100865 WP_000079590.1.100886 WP_000079590.1.100895 WP_000079590.1.100932 WP_000079590.1.100941 WP_000079590.1.100953 WP_000079590.1.101011 WP_000079590.1.101042 WP_000079590.1.10108 WP_000079590.1.101094 WP_000079590.1.101112 WP_000079590.1.101126 WP_000079590.1.101147 WP_000079590.1.101199 WP_000079590.1.101223 WP_000079590.1.101226 WP_000079590.1.10124 WP_000079590.1.101271 WP_000079590.1.1013 WP_000079590.1.101312 WP_000079590.1.101320 WP_000079590.1.101322 WP_000079590.1.101374 WP_000079590.1.101454 WP_000079590.1.101473 WP_000079590.1.101541 WP_000079590.1.101609 WP_000079590.1.101612 WP_000079590.1.101616 WP_000079590.1.101634 WP_000079590.1.101636 WP_000079590.1.101639 WP_000079590.1.10164 WP_000079590.1.101666 WP_000079590.1.101674 WP_000079590.1.101740 WP_000079590.1.101741 WP_000079590.1.101759 WP_000079590.1.10177 WP_000079590.1.101776 WP_000079590.1.101815 WP_000079590.1.101832 WP_000079590.1.101890 WP_000079590.1.101917 WP_000079590.1.101927 WP_000079590.1.101941 WP_000079590.1.101975 WP_000079590.1.102009 WP_000079590.1.102050 WP_000079590.1.102087 WP_000079590.1.102103 WP_000079590.1.102111 WP_000079590.1.10231 WP_000079590.1.10276 WP_000079590.1.10293 WP_000079590.1.10300 WP_000079590.1.10338 WP_000079590.1.1038 WP_000079590.1.10394 WP_000079590.1.104 WP_000079590.1.10401 WP_000079590.1.10428 WP_000079590.1.10459 WP_000079590.1.10463 WP_000079590.1.10475 WP_000079590.1.10498 WP_000079590.1.10507 WP_000079590.1.10511 WP_000079590.1.10514 WP_000079590.1.10530 WP_000079590.1.10532 WP_000079590.1.10547 WP_000079590.1.10562 WP_000079590.1.10566 WP_000079590.1.10595 WP_000079590.1.106 WP_000079590.1.10631 WP_000079590.1.10642 WP_000079590.1.10654 WP_000079590.1.10677 WP_000079590.1.10711 WP_000079590.1.10720 WP_000079590.1.10755 WP_000079590.1.10797 WP_000079590.1.10857 WP_000079590.1.10868 WP_000079590.1.10873 WP_000079590.1.10898 WP_000079590.1.10926 WP_000079590.1.10936 WP_000079590.1.11000 WP_000079590.1.11012 WP_000079590.1.11041 WP_000079590.1.11055 WP_000079590.1.1110 WP_000079590.1.11119 WP_000079590.1.11126 WP_000079590.1.11142 WP_000079590.1.11156 WP_000079590.1.11213 WP_000079590.1.11216 WP_000079590.1.11239 WP_000079590.1.11253 WP_000079590.1.11254 WP_000079590.1.11314 WP_000079590.1.1135 WP_000079590.1.11369 WP_000079590.1.1137 WP_000079590.1.11385 WP_000079590.1.11405 WP_000079590.1.1142 WP_000079590.1.11426 WP_000079590.1.11429 WP_000079590.1.11479 WP_000079590.1.1150 WP_000079590.1.11526 WP_000079590.1.11528 WP_000079590.1.11544 WP_000079590.1.11557 WP_000079590.1.1156 WP_000079590.1.11565 WP_000079590.1.11567 WP_000079590.1.11588 WP_000079590.1.11603 WP_000079590.1.11621 WP_000079590.1.11638 WP_000079590.1.11677 WP_000079590.1.11687 WP_000079590.1.1169 WP_000079590.1.11735 WP_000079590.1.1174 WP_000079590.1.11824 WP_000079590.1.11834 WP_000079590.1.11841 WP_000079590.1.11875 WP_000079590.1.11883 WP_000079590.1.11900 WP_000079590.1.11908 WP_000079590.1.11914 WP_000079590.1.11936 WP_000079590.1.11964 WP_000079590.1.11978 WP_000079590.1.12007 WP_000079590.1.12017 WP_000079590.1.12025 WP_000079590.1.12027 WP_000079590.1.12040 WP_000079590.1.12047 WP_000079590.1.12059 WP_000079590.1.12061 WP_000079590.1.12063 WP_000079590.1.1207 WP_000079590.1.12106 WP_000079590.1.12141 WP_000079590.1.1215 WP_000079590.1.12160 WP_000079590.1.12168 WP_000079590.1.12172 WP_000079590.1.12192 WP_000079590.1.1224 WP_000079590.1.12282 WP_000079590.1.12340 WP_000079590.1.12364 WP_000079590.1.12374 WP_000079590.1.12396 WP_000079590.1.12397 WP_000079590.1.12398 WP_000079590.1.12441 WP_000079590.1.12456 WP_000079590.1.1246 WP_000079590.1.12484 WP_000079590.1.12485 WP_000079590.1.1250 WP_000079590.1.12517 WP_000079590.1.12568 WP_000079590.1.12569 WP_000079590.1.12581 WP_000079590.1.12585 WP_000079590.1.12620 WP_000079590.1.12648 WP_000079590.1.12650 WP_000079590.1.12683 WP_000079590.1.12696 WP_000079590.1.12701 WP_000079590.1.12726 WP_000079590.1.12727 WP_000079590.1.12741 WP_000079590.1.12834 WP_000079590.1.12864 WP_000079590.1.12877 WP_000079590.1.1300 WP_000079590.1.13076 WP_000079590.1.13102 WP_000079590.1.13108 WP_000079590.1.13161 WP_000079590.1.13207 WP_000079590.1.1321 WP_000079590.1.13247 WP_000079590.1.13268 WP_000079590.1.13274 WP_000079590.1.13291 WP_000079590.1.133 WP_000079590.1.13314 WP_000079590.1.13334 WP_000079590.1.13338 WP_000079590.1.13342 WP_000079590.1.13352 WP_000079590.1.13367 WP_000079590.1.13391 WP_000079590.1.13406 WP_000079590.1.13440 WP_000079590.1.13443 WP_000079590.1.13446 WP_000079590.1.1346 WP_000079590.1.13476 WP_000079590.1.13543 WP_000079590.1.13573 WP_000079590.1.13599 WP_000079590.1.13625 WP_000079590.1.13661 WP_000079590.1.13686 WP_000079590.1.1372 WP_000079590.1.13732 WP_000079590.1.13750 WP_000079590.1.13799 WP_000079590.1.13819 WP_000079590.1.1382 WP_000079590.1.13827 WP_000079590.1.13829 WP_000079590.1.13848 WP_000079590.1.1397 WP_000079590.1.13972 WP_000079590.1.140 WP_000079590.1.1401 WP_000079590.1.14011 WP_000079590.1.14050 WP_000079590.1.14056 WP_000079590.1.1408 WP_000079590.1.14089 WP_000079590.1.14099 WP_000079590.1.14111 WP_000079590.1.1412 WP_000079590.1.14120 WP_000079590.1.14123 WP_000079590.1.14150 WP_000079590.1.14191 WP_000079590.1.14197 WP_000079590.1.14280 WP_000079590.1.14296 WP_000079590.1.14333 WP_000079590.1.14399 WP_000079590.1.14436 WP_000079590.1.14444 WP_000079590.1.14446 WP_000079590.1.14458 WP_000079590.1.14467 WP_000079590.1.14474 WP_000079590.1.14500 WP_000079590.1.14519 WP_000079590.1.14526 WP_000079590.1.14528 WP_000079590.1.14550 WP_000079590.1.14575 WP_000079590.1.146 WP_000079590.1.14618 WP_000079590.1.14701 WP_000079590.1.14703 WP_000079590.1.14706 WP_000079590.1.14708 WP_000079590.1.14719 WP_000079590.1.1473 WP_000079590.1.14765 WP_000079590.1.14789 WP_000079590.1.14793 WP_000079590.1.14808 WP_000079590.1.14810 WP_000079590.1.14819 WP_000079590.1.14876 WP_000079590.1.14877 WP_000079590.1.14884 WP_000079590.1.14894 WP_000079590.1.14913 WP_000079590.1.14917 WP_000079590.1.14930 WP_000079590.1.14936 WP_000079590.1.14947 WP_000079590.1.14948 WP_000079590.1.15046 WP_000079590.1.15054 WP_000079590.1.15059 WP_000079590.1.15067 WP_000079590.1.15100 WP_000079590.1.15102 WP_000079590.1.15184 WP_000079590.1.15214 WP_000079590.1.15244 WP_000079590.1.15265 WP_000079590.1.15276 WP_000079590.1.15318 WP_000079590.1.15353 WP_000079590.1.15362 WP_000079590.1.15415 WP_000079590.1.15423 WP_000079590.1.15433 WP_000079590.1.15439 WP_000079590.1.15479 WP_000079590.1.15487 WP_000079590.1.1551 WP_000079590.1.15535 WP_000079590.1.15581 WP_000079590.1.15585 WP_000079590.1.15586 WP_000079590.1.15597 WP_000079590.1.15627 WP_000079590.1.15644 WP_000079590.1.1568 WP_000079590.1.15710 WP_000079590.1.15717 WP_000079590.1.15775 WP_000079590.1.15777 WP_000079590.1.15795 WP_000079590.1.15835 WP_000079590.1.15862 WP_000079590.1.15881 WP_000079590.1.15905 WP_000079590.1.15910 WP_000079590.1.15912 WP_000079590.1.1592 WP_000079590.1.15970 WP_000079590.1.15978 WP_000079590.1.15986 WP_000079590.1.15995 WP_000079590.1.16004 WP_000079590.1.16028 WP_000079590.1.16046 WP_000079590.1.16047 WP_000079590.1.16051 WP_000079590.1.16052 WP_000079590.1.16058 WP_000079590.1.1611 WP_000079590.1.16150 WP_000079590.1.16155 WP_000079590.1.16158 WP_000079590.1.16166 WP_000079590.1.16172 WP_000079590.1.16244 WP_000079590.1.1626 WP_000079590.1.16264 WP_000079590.1.16273 WP_000079590.1.16344 WP_000079590.1.16361 WP_000079590.1.16363 WP_000079590.1.16365 WP_000079590.1.16366 WP_000079590.1.16394 WP_000079590.1.16452 WP_000079590.1.16453 WP_000079590.1.16461 WP_000079590.1.16462 WP_000079590.1.16465 WP_000079590.1.16474 WP_000079590.1.16508 WP_000079590.1.16522 WP_000079590.1.16525 WP_000079590.1.16551 WP_000079590.1.16565 WP_000079590.1.16581 WP_000079590.1.16588 WP_000079590.1.16656 WP_000079590.1.16658 WP_000079590.1.16666 WP_000079590.1.16673 WP_000079590.1.1668 WP_000079590.1.167 WP_000079590.1.16729 WP_000079590.1.16736 WP_000079590.1.1674 WP_000079590.1.16767 WP_000079590.1.16781 WP_000079590.1.16804 WP_000079590.1.16826 WP_000079590.1.16855 WP_000079590.1.16873 WP_000079590.1.16879 WP_000079590.1.16893 WP_000079590.1.16903 WP_000079590.1.16905 WP_000079590.1.16910 WP_000079590.1.16948 WP_000079590.1.16949 WP_000079590.1.16972 WP_000079590.1.16998 WP_000079590.1.17031 WP_000079590.1.17049 WP_000079590.1.17058 WP_000079590.1.17060 WP_000079590.1.17078 WP_000079590.1.17093 WP_000079590.1.17096 WP_000079590.1.17105 WP_000079590.1.17188 WP_000079590.1.17202 WP_000079590.1.17219 WP_000079590.1.1722 WP_000079590.1.17270 WP_000079590.1.17302 WP_000079590.1.17308 WP_000079590.1.1733 WP_000079590.1.17368 WP_000079590.1.17405 WP_000079590.1.17406 WP_000079590.1.17482 WP_000079590.1.17513 WP_000079590.1.17525 WP_000079590.1.17543 WP_000079590.1.17563 WP_000079590.1.1757 WP_000079590.1.17578 WP_000079590.1.17583 WP_000079590.1.17622 WP_000079590.1.17629 WP_000079590.1.17659 WP_000079590.1.17667 WP_000079590.1.17686 WP_000079590.1.17693 WP_000079590.1.17703 WP_000079590.1.17732 WP_000079590.1.17741 WP_000079590.1.17743 WP_000079590.1.17747 WP_000079590.1.17840 WP_000079590.1.17886 WP_000079590.1.17891 WP_000079590.1.17914 WP_000079590.1.17936 WP_000079590.1.17949 WP_000079590.1.17956 WP_000079590.1.1798 WP_000079590.1.18005 WP_000079590.1.1801 WP_000079590.1.18021 WP_000079590.1.18056 WP_000079590.1.18061 WP_000079590.1.1807 WP_000079590.1.18089 WP_000079590.1.18092 WP_000079590.1.18099 WP_000079590.1.18109 WP_000079590.1.18122 WP_000079590.1.18124 WP_000079590.1.1814 WP_000079590.1.18144 WP_000079590.1.18149 WP_000079590.1.18173 WP_000079590.1.18177 WP_000079590.1.18178 WP_000079590.1.1818 WP_000079590.1.18192 WP_000079590.1.1825 WP_000079590.1.18254 WP_000079590.1.18270 WP_000079590.1.18277 WP_000079590.1.18280 WP_000079590.1.18282 WP_000079590.1.18328 WP_000079590.1.18358 WP_000079590.1.18365 WP_000079590.1.18370 WP_000079590.1.18384 WP_000079590.1.18406 WP_000079590.1.18426 WP_000079590.1.18445 WP_000079590.1.18474 WP_000079590.1.18485 WP_000079590.1.18489 WP_000079590.1.18513 WP_000079590.1.18610 WP_000079590.1.18641 WP_000079590.1.18678 WP_000079590.1.18686 WP_000079590.1.18722 WP_000079590.1.18737 WP_000079590.1.18766 WP_000079590.1.1880 WP_000079590.1.18847 WP_000079590.1.1885 WP_000079590.1.18860 WP_000079590.1.18886 WP_000079590.1.18895 WP_000079590.1.18919 WP_000079590.1.18922 WP_000079590.1.1895 WP_000079590.1.18959 WP_000079590.1.18972 WP_000079590.1.19001 WP_000079590.1.19006 WP_000079590.1.19030 WP_000079590.1.19038 WP_000079590.1.19044 WP_000079590.1.19055 WP_000079590.1.19064 WP_000079590.1.19084 WP_000079590.1.19093 WP_000079590.1.19174 WP_000079590.1.19187 WP_000079590.1.19228 WP_000079590.1.19273 WP_000079590.1.19288 WP_000079590.1.19300 WP_000079590.1.19340 WP_000079590.1.19357 WP_000079590.1.19373 WP_000079590.1.1939 WP_000079590.1.19405 WP_000079590.1.19422 WP_000079590.1.19433 WP_000079590.1.19454 WP_000079590.1.19456 WP_000079590.1.19469 WP_000079590.1.19496 WP_000079590.1.19535 WP_000079590.1.19538 WP_000079590.1.1955 WP_000079590.1.19588 WP_000079590.1.19589 WP_000079590.1.19616 WP_000079590.1.19642 WP_000079590.1.19656 WP_000079590.1.19663 WP_000079590.1.1968 WP_000079590.1.19683 WP_000079590.1.19686 WP_000079590.1.19731 WP_000079590.1.19740 WP_000079590.1.19793 WP_000079590.1.19794 WP_000079590.1.19823 WP_000079590.1.19834 WP_000079590.1.19851 WP_000079590.1.19863 WP_000079590.1.1992 WP_000079590.1.19938 WP_000079590.1.19967 WP_000079590.1.19970 WP_000079590.1.19975 WP_000079590.1.19999 WP_000079590.1.20023 WP_000079590.1.20081 WP_000079590.1.20086 WP_000079590.1.20089 WP_000079590.1.20091 WP_000079590.1.20218 WP_000079590.1.20254 WP_000079590.1.20255 WP_000079590.1.2026 WP_000079590.1.20261 WP_000079590.1.20296 WP_000079590.1.20330 WP_000079590.1.20339 WP_000079590.1.2036 WP_000079590.1.20364 WP_000079590.1.2041 WP_000079590.1.20415 WP_000079590.1.20419 WP_000079590.1.20437 WP_000079590.1.20446 WP_000079590.1.20465 WP_000079590.1.2047 WP_000079590.1.20488 WP_000079590.1.20492 WP_000079590.1.20503 WP_000079590.1.2053 WP_000079590.1.20573 WP_000079590.1.20614 WP_000079590.1.20635 WP_000079590.1.20718 WP_000079590.1.2073 WP_000079590.1.20740 WP_000079590.1.20760 WP_000079590.1.20767 WP_000079590.1.20787 WP_000079590.1.20795 WP_000079590.1.20810 WP_000079590.1.20828 WP_000079590.1.20862 WP_000079590.1.2087 WP_000079590.1.20883 WP_000079590.1.20894 WP_000079590.1.20900 WP_000079590.1.2091 WP_000079590.1.20947 WP_000079590.1.20953 WP_000079590.1.2101 WP_000079590.1.21010 WP_000079590.1.2106 WP_000079590.1.21062 WP_000079590.1.2107 WP_000079590.1.21075 WP_000079590.1.21079 WP_000079590.1.21086 WP_000079590.1.21089 WP_000079590.1.21103 WP_000079590.1.21136 WP_000079590.1.21144 WP_000079590.1.2116 WP_000079590.1.21162 WP_000079590.1.21165 WP_000079590.1.21181 WP_000079590.1.21184 WP_000079590.1.21185 WP_000079590.1.21194 WP_000079590.1.21202 WP_000079590.1.21241 WP_000079590.1.21332 WP_000079590.1.21351 WP_000079590.1.21362 WP_000079590.1.21366 WP_000079590.1.21404 WP_000079590.1.21453 WP_000079590.1.2146 WP_000079590.1.21473 WP_000079590.1.21492 WP_000079590.1.21548 WP_000079590.1.21616 WP_000079590.1.2166 WP_000079590.1.21674 WP_000079590.1.21681 WP_000079590.1.21692 WP_000079590.1.21715 WP_000079590.1.21728 WP_000079590.1.21730 WP_000079590.1.21750 WP_000079590.1.21825 WP_000079590.1.21845 WP_000079590.1.21886 WP_000079590.1.21909 WP_000079590.1.21940 WP_000079590.1.21946 WP_000079590.1.21950 WP_000079590.1.21966 WP_000079590.1.21981 WP_000079590.1.21991 WP_000079590.1.22019 WP_000079590.1.22051 WP_000079590.1.22064 WP_000079590.1.22069 WP_000079590.1.22096 WP_000079590.1.22117 WP_000079590.1.22118 WP_000079590.1.22126 WP_000079590.1.22136 WP_000079590.1.22158 WP_000079590.1.2216 WP_000079590.1.22162 WP_000079590.1.22208 WP_000079590.1.22235 WP_000079590.1.22240 WP_000079590.1.2227 WP_000079590.1.22296 WP_000079590.1.22315 WP_000079590.1.22323 WP_000079590.1.22337 WP_000079590.1.22346 WP_000079590.1.22373 WP_000079590.1.22449 WP_000079590.1.22453 WP_000079590.1.22454 WP_000079590.1.22460 WP_000079590.1.22476 WP_000079590.1.22537 WP_000079590.1.22590 WP_000079590.1.22595 WP_000079590.1.22604 WP_000079590.1.22605 WP_000079590.1.22614 WP_000079590.1.22623 WP_000079590.1.22652 WP_000079590.1.22676 WP_000079590.1.22683 WP_000079590.1.22692 WP_000079590.1.22758 WP_000079590.1.22760 WP_000079590.1.2284 WP_000079590.1.22855 WP_000079590.1.22857 WP_000079590.1.22864 WP_000079590.1.22880 WP_000079590.1.22895 WP_000079590.1.22902 WP_000079590.1.22926 WP_000079590.1.22943 WP_000079590.1.22947 WP_000079590.1.22966 WP_000079590.1.22967 WP_000079590.1.23010 WP_000079590.1.23040 WP_000079590.1.23053 WP_000079590.1.23058 WP_000079590.1.23080 WP_000079590.1.23148 WP_000079590.1.23218 WP_000079590.1.2324 WP_000079590.1.23258 WP_000079590.1.23274 WP_000079590.1.23279 WP_000079590.1.2331 WP_000079590.1.2332 WP_000079590.1.23329 WP_000079590.1.23340 WP_000079590.1.2336 WP_000079590.1.23365 WP_000079590.1.23379 WP_000079590.1.23412 WP_000079590.1.23426 WP_000079590.1.23442 WP_000079590.1.23444 WP_000079590.1.23485 WP_000079590.1.23492 WP_000079590.1.235 WP_000079590.1.23503 WP_000079590.1.23509 WP_000079590.1.23513 WP_000079590.1.23515 WP_000079590.1.23529 WP_000079590.1.23548 WP_000079590.1.23571 WP_000079590.1.2358 WP_000079590.1.23587 WP_000079590.1.23604 WP_000079590.1.23629 WP_000079590.1.23631 WP_000079590.1.23639 WP_000079590.1.23646 WP_000079590.1.23675 WP_000079590.1.23679 WP_000079590.1.23707 WP_000079590.1.23728 WP_000079590.1.23746 WP_000079590.1.2375 WP_000079590.1.23783 WP_000079590.1.23786 WP_000079590.1.23787 WP_000079590.1.23801 WP_000079590.1.23959 WP_000079590.1.24028 WP_000079590.1.24061 WP_000079590.1.24082 WP_000079590.1.24083 WP_000079590.1.24117 WP_000079590.1.24125 WP_000079590.1.24138 WP_000079590.1.24145 WP_000079590.1.24153 WP_000079590.1.24158 WP_000079590.1.24214 WP_000079590.1.24250 WP_000079590.1.24291 WP_000079590.1.24297 WP_000079590.1.24303 WP_000079590.1.24322 WP_000079590.1.24355 WP_000079590.1.24361 WP_000079590.1.24375 WP_000079590.1.24376 WP_000079590.1.24400 WP_000079590.1.24408 WP_000079590.1.24409 WP_000079590.1.24412 WP_000079590.1.24420 WP_000079590.1.24450 WP_000079590.1.24476 WP_000079590.1.24494 WP_000079590.1.24521 WP_000079590.1.24555 WP_000079590.1.24619 WP_000079590.1.24643 WP_000079590.1.24673 WP_000079590.1.24688 WP_000079590.1.24689 WP_000079590.1.24696 WP_000079590.1.24716 WP_000079590.1.24723 WP_000079590.1.24803 WP_000079590.1.2481 WP_000079590.1.24832 WP_000079590.1.24837 WP_000079590.1.24873 WP_000079590.1.24901 WP_000079590.1.24944 WP_000079590.1.24964 WP_000079590.1.24995 WP_000079590.1.25017 WP_000079590.1.25032 WP_000079590.1.25041 WP_000079590.1.25053 WP_000079590.1.25119 WP_000079590.1.25130 WP_000079590.1.25140 WP_000079590.1.25159 WP_000079590.1.25175 WP_000079590.1.25185 WP_000079590.1.25196 WP_000079590.1.25205 WP_000079590.1.25206 WP_000079590.1.25210 WP_000079590.1.25219 WP_000079590.1.25229 WP_000079590.1.2525 WP_000079590.1.25297 WP_000079590.1.25304 WP_000079590.1.25354 WP_000079590.1.25374 WP_000079590.1.25397 WP_000079590.1.25421 WP_000079590.1.25426 WP_000079590.1.25475 WP_000079590.1.25490 WP_000079590.1.25508 WP_000079590.1.25512 WP_000079590.1.25514 WP_000079590.1.25546 WP_000079590.1.25564 WP_000079590.1.25596 WP_000079590.1.25603 WP_000079590.1.25607 WP_000079590.1.25618 WP_000079590.1.2562 WP_000079590.1.25666 WP_000079590.1.2568 WP_000079590.1.25692 WP_000079590.1.25700 WP_000079590.1.25703 WP_000079590.1.25709 WP_000079590.1.25780 WP_000079590.1.25807 WP_000079590.1.25809 WP_000079590.1.25821 WP_000079590.1.25825 WP_000079590.1.25833 WP_000079590.1.25835 WP_000079590.1.25882 WP_000079590.1.25911 WP_000079590.1.25928 WP_000079590.1.25951 WP_000079590.1.25962 WP_000079590.1.25963 WP_000079590.1.26001 WP_000079590.1.26027 WP_000079590.1.26034 WP_000079590.1.26075 WP_000079590.1.26083 WP_000079590.1.26093 WP_000079590.1.26107 WP_000079590.1.26123 WP_000079590.1.26129 WP_000079590.1.2615 WP_000079590.1.26194 WP_000079590.1.26199 WP_000079590.1.26217 WP_000079590.1.26224 WP_000079590.1.26230 WP_000079590.1.26232 WP_000079590.1.26272 WP_000079590.1.26286 WP_000079590.1.26288 WP_000079590.1.26384 WP_000079590.1.26394 WP_000079590.1.26441 WP_000079590.1.26491 WP_000079590.1.26532 WP_000079590.1.2654 WP_000079590.1.26554 WP_000079590.1.26587 WP_000079590.1.26636 WP_000079590.1.26646 WP_000079590.1.2667 WP_000079590.1.26687 WP_000079590.1.26689 WP_000079590.1.26709 WP_000079590.1.2672 WP_000079590.1.26741 WP_000079590.1.26787 WP_000079590.1.2679 WP_000079590.1.26794 WP_000079590.1.26833 WP_000079590.1.26882 WP_000079590.1.26883 WP_000079590.1.26908 WP_000079590.1.26919 WP_000079590.1.2692 WP_000079590.1.26928 WP_000079590.1.26936 WP_000079590.1.26980 WP_000079590.1.270 WP_000079590.1.27008 WP_000079590.1.27027 WP_000079590.1.27051 WP_000079590.1.27055 WP_000079590.1.27070 WP_000079590.1.27072 WP_000079590.1.27077 WP_000079590.1.27084 WP_000079590.1.27086 WP_000079590.1.27087 WP_000079590.1.27111 WP_000079590.1.27115 WP_000079590.1.2713 WP_000079590.1.27142 WP_000079590.1.2717 WP_000079590.1.272 WP_000079590.1.27223 WP_000079590.1.27228 WP_000079590.1.2723 WP_000079590.1.27255 WP_000079590.1.27272 WP_000079590.1.27282 WP_000079590.1.27285 WP_000079590.1.27309 WP_000079590.1.27314 WP_000079590.1.27329 WP_000079590.1.27361 WP_000079590.1.27383 WP_000079590.1.27452 WP_000079590.1.27523 WP_000079590.1.27544 WP_000079590.1.27547 WP_000079590.1.27565 WP_000079590.1.27595 WP_000079590.1.27598 WP_000079590.1.27632 WP_000079590.1.27638 WP_000079590.1.27655 WP_000079590.1.27658 WP_000079590.1.27706 WP_000079590.1.27775 WP_000079590.1.27776 WP_000079590.1.27785 WP_000079590.1.27798 WP_000079590.1.27800 WP_000079590.1.27833 WP_000079590.1.27883 WP_000079590.1.27900 WP_000079590.1.27928 WP_000079590.1.27945 WP_000079590.1.27995 WP_000079590.1.28002 WP_000079590.1.28004 WP_000079590.1.28032 WP_000079590.1.28037 WP_000079590.1.28056 WP_000079590.1.2806 WP_000079590.1.2809 WP_000079590.1.28116 WP_000079590.1.28126 WP_000079590.1.28139 WP_000079590.1.28155 WP_000079590.1.28174 WP_000079590.1.28198 WP_000079590.1.28200 WP_000079590.1.2822 WP_000079590.1.28229 WP_000079590.1.28232 WP_000079590.1.28233 WP_000079590.1.28235 WP_000079590.1.28267 WP_000079590.1.2829 WP_000079590.1.28301 WP_000079590.1.28303 WP_000079590.1.28384 WP_000079590.1.28386 WP_000079590.1.28393 WP_000079590.1.28395 WP_000079590.1.2845 WP_000079590.1.28462 WP_000079590.1.28479 WP_000079590.1.28514 WP_000079590.1.2853 WP_000079590.1.28570 WP_000079590.1.28620 WP_000079590.1.28627 WP_000079590.1.28692 WP_000079590.1.2873 WP_000079590.1.28733 WP_000079590.1.28773 WP_000079590.1.28775 WP_000079590.1.28776 WP_000079590.1.28811 WP_000079590.1.28902 WP_000079590.1.28917 WP_000079590.1.28948 WP_000079590.1.28962 WP_000079590.1.28963 WP_000079590.1.28977 WP_000079590.1.29023 WP_000079590.1.29042 WP_000079590.1.2905 WP_000079590.1.2907 WP_000079590.1.29081 WP_000079590.1.29089 WP_000079590.1.29113 WP_000079590.1.29130 WP_000079590.1.29153 WP_000079590.1.29168 WP_000079590.1.29190 WP_000079590.1.29203 WP_000079590.1.29218 WP_000079590.1.29237 WP_000079590.1.2924 WP_000079590.1.29248 WP_000079590.1.29274 WP_000079590.1.29288 WP_000079590.1.2932 WP_000079590.1.29349 WP_000079590.1.29379 WP_000079590.1.29389 WP_000079590.1.29422 WP_000079590.1.29436 WP_000079590.1.29439 WP_000079590.1.29454 WP_000079590.1.2946 WP_000079590.1.29462 WP_000079590.1.29509 WP_000079590.1.29563 WP_000079590.1.29576 WP_000079590.1.29711 WP_000079590.1.29727 WP_000079590.1.29732 WP_000079590.1.29743 WP_000079590.1.29774 WP_000079590.1.29782 WP_000079590.1.29827 WP_000079590.1.29833 WP_000079590.1.2984 WP_000079590.1.29845 WP_000079590.1.29851 WP_000079590.1.29865 WP_000079590.1.29886 WP_000079590.1.29898 WP_000079590.1.29919 WP_000079590.1.2994 WP_000079590.1.29964 WP_000079590.1.29983 WP_000079590.1.29990 WP_000079590.1.30009 WP_000079590.1.30013 WP_000079590.1.3002 WP_000079590.1.30022 WP_000079590.1.30034 WP_000079590.1.30049 WP_000079590.1.3005 WP_000079590.1.30058 WP_000079590.1.30059 WP_000079590.1.30086 WP_000079590.1.30093 WP_000079590.1.30165 WP_000079590.1.30172 WP_000079590.1.30179 WP_000079590.1.30185 WP_000079590.1.30202 WP_000079590.1.30210 WP_000079590.1.30225 WP_000079590.1.30238 WP_000079590.1.30278 WP_000079590.1.30331 WP_000079590.1.30354 WP_000079590.1.30357 WP_000079590.1.30362 WP_000079590.1.30386 WP_000079590.1.30389 WP_000079590.1.3042 WP_000079590.1.30421 WP_000079590.1.30440 WP_000079590.1.30448 WP_000079590.1.30489 WP_000079590.1.30492 WP_000079590.1.30517 WP_000079590.1.30542 WP_000079590.1.30544 WP_000079590.1.30548 WP_000079590.1.30556 WP_000079590.1.30572 WP_000079590.1.30585 WP_000079590.1.30589 WP_000079590.1.30618 WP_000079590.1.30619 WP_000079590.1.30627 WP_000079590.1.3066 WP_000079590.1.30664 WP_000079590.1.3067 WP_000079590.1.3068 WP_000079590.1.30688 WP_000079590.1.30696 WP_000079590.1.30752 WP_000079590.1.3080 WP_000079590.1.30803 WP_000079590.1.30806 WP_000079590.1.30819 WP_000079590.1.30934 WP_000079590.1.3095 WP_000079590.1.30967 WP_000079590.1.30968 WP_000079590.1.31001 WP_000079590.1.31046 WP_000079590.1.31066 WP_000079590.1.31078 WP_000079590.1.31086 WP_000079590.1.31092 WP_000079590.1.31111 WP_000079590.1.31122 WP_000079590.1.31139 WP_000079590.1.3114 WP_000079590.1.31145 WP_000079590.1.31155 WP_000079590.1.31156 WP_000079590.1.31167 WP_000079590.1.31171 WP_000079590.1.31182 WP_000079590.1.31205 WP_000079590.1.3121 WP_000079590.1.31214 WP_000079590.1.31219 WP_000079590.1.31222 WP_000079590.1.31223 WP_000079590.1.31262 WP_000079590.1.31272 WP_000079590.1.31303 WP_000079590.1.3131 WP_000079590.1.31335 WP_000079590.1.31352 WP_000079590.1.31389 WP_000079590.1.31413 WP_000079590.1.31435 WP_000079590.1.31446 WP_000079590.1.31451 WP_000079590.1.31533 WP_000079590.1.31585 WP_000079590.1.31665 WP_000079590.1.3167 WP_000079590.1.3170 WP_000079590.1.31720 WP_000079590.1.31725 WP_000079590.1.31782 WP_000079590.1.31799 WP_000079590.1.31836 WP_000079590.1.3185 WP_000079590.1.31895 WP_000079590.1.31901 WP_000079590.1.31927 WP_000079590.1.31951 WP_000079590.1.31983 WP_000079590.1.32006 WP_000079590.1.32041 WP_000079590.1.32042 WP_000079590.1.32054 WP_000079590.1.3207 WP_000079590.1.32109 WP_000079590.1.32116 WP_000079590.1.32189 WP_000079590.1.32202 WP_000079590.1.32204 WP_000079590.1.32252 WP_000079590.1.32255 WP_000079590.1.32260 WP_000079590.1.32263 WP_000079590.1.32274 WP_000079590.1.32275 WP_000079590.1.32293 WP_000079590.1.32299 WP_000079590.1.32309 WP_000079590.1.32422 WP_000079590.1.32423 WP_000079590.1.32424 WP_000079590.1.32425 WP_000079590.1.32458 WP_000079590.1.32459 WP_000079590.1.32460 WP_000079590.1.32491 WP_000079590.1.32519 WP_000079590.1.32527 WP_000079590.1.32529 WP_000079590.1.32563 WP_000079590.1.32578 WP_000079590.1.32617 WP_000079590.1.32624 WP_000079590.1.32668 WP_000079590.1.3270 WP_000079590.1.32725 WP_000079590.1.32740 WP_000079590.1.32750 WP_000079590.1.3278 WP_000079590.1.32832 WP_000079590.1.32838 WP_000079590.1.32848 WP_000079590.1.32860 WP_000079590.1.32868 WP_000079590.1.32881 WP_000079590.1.32899 WP_000079590.1.3290 WP_000079590.1.32900 WP_000079590.1.32940 WP_000079590.1.32941 WP_000079590.1.3296 WP_000079590.1.32961 WP_000079590.1.32966 WP_000079590.1.32977 WP_000079590.1.32985 WP_000079590.1.33010 WP_000079590.1.33037 WP_000079590.1.3304 WP_000079590.1.3305 WP_000079590.1.33051 WP_000079590.1.33065 WP_000079590.1.33106 WP_000079590.1.33122 WP_000079590.1.3315 WP_000079590.1.33208 WP_000079590.1.33214 WP_000079590.1.33247 WP_000079590.1.33253 WP_000079590.1.33270 WP_000079590.1.33280 WP_000079590.1.33283 WP_000079590.1.33313 WP_000079590.1.33339 WP_000079590.1.33343 WP_000079590.1.33382 WP_000079590.1.33392 WP_000079590.1.33409 WP_000079590.1.33486 WP_000079590.1.33490 WP_000079590.1.335 WP_000079590.1.33501 WP_000079590.1.33529 WP_000079590.1.3356 WP_000079590.1.33580 WP_000079590.1.33586 WP_000079590.1.33629 WP_000079590.1.3364 WP_000079590.1.33659 WP_000079590.1.33689 WP_000079590.1.3370 WP_000079590.1.33730 WP_000079590.1.33741 WP_000079590.1.33786 WP_000079590.1.33840 WP_000079590.1.33865 WP_000079590.1.33870 WP_000079590.1.3392 WP_000079590.1.33926 WP_000079590.1.3394 WP_000079590.1.3395 WP_000079590.1.33957 WP_000079590.1.3396 WP_000079590.1.33969 WP_000079590.1.33986 WP_000079590.1.34 WP_000079590.1.34001 WP_000079590.1.34022 WP_000079590.1.34059 WP_000079590.1.34081 WP_000079590.1.34084 WP_000079590.1.34091 WP_000079590.1.34118 WP_000079590.1.34126 WP_000079590.1.34185 WP_000079590.1.34211 WP_000079590.1.34214 WP_000079590.1.34234 WP_000079590.1.34284 WP_000079590.1.34292 WP_000079590.1.34304 WP_000079590.1.34330 WP_000079590.1.34376 WP_000079590.1.3438 WP_000079590.1.34382 WP_000079590.1.34417 WP_000079590.1.34431 WP_000079590.1.34454 WP_000079590.1.34458 WP_000079590.1.34484 WP_000079590.1.34517 WP_000079590.1.34530 WP_000079590.1.34614 WP_000079590.1.34647 WP_000079590.1.34659 WP_000079590.1.34665 WP_000079590.1.34684 WP_000079590.1.34694 WP_000079590.1.34711 WP_000079590.1.34751 WP_000079590.1.34808 WP_000079590.1.34820 WP_000079590.1.34824 WP_000079590.1.34834 WP_000079590.1.34854 WP_000079590.1.34881 WP_000079590.1.34932 WP_000079590.1.34962 WP_000079590.1.34972 WP_000079590.1.34977 WP_000079590.1.35001 WP_000079590.1.35035 WP_000079590.1.35040 WP_000079590.1.35074 WP_000079590.1.35075 WP_000079590.1.35125 WP_000079590.1.35175 WP_000079590.1.35193 WP_000079590.1.35219 WP_000079590.1.35240 WP_000079590.1.35274 WP_000079590.1.35294 WP_000079590.1.35298 WP_000079590.1.35321 WP_000079590.1.35332 WP_000079590.1.3541 WP_000079590.1.35429 WP_000079590.1.35494 WP_000079590.1.35532 WP_000079590.1.35560 WP_000079590.1.35563 WP_000079590.1.3557 WP_000079590.1.35570 WP_000079590.1.35594 WP_000079590.1.35619 WP_000079590.1.35624 WP_000079590.1.35628 WP_000079590.1.35648 WP_000079590.1.3570 WP_000079590.1.35712 WP_000079590.1.35713 WP_000079590.1.3572 WP_000079590.1.35736 WP_000079590.1.35777 WP_000079590.1.35791 WP_000079590.1.35795 WP_000079590.1.35809 WP_000079590.1.35835 WP_000079590.1.35868 WP_000079590.1.35870 WP_000079590.1.35887 WP_000079590.1.35892 WP_000079590.1.35916 WP_000079590.1.35936 WP_000079590.1.35938 WP_000079590.1.35961 WP_000079590.1.35966 WP_000079590.1.36000 WP_000079590.1.36011 WP_000079590.1.36017 WP_000079590.1.36034 WP_000079590.1.36036 WP_000079590.1.36037 WP_000079590.1.36063 WP_000079590.1.36069 WP_000079590.1.36172 WP_000079590.1.36229 WP_000079590.1.36232 WP_000079590.1.36286 WP_000079590.1.36291 WP_000079590.1.36298 WP_000079590.1.36308 WP_000079590.1.36323 WP_000079590.1.36343 WP_000079590.1.36409 WP_000079590.1.36425 WP_000079590.1.36445 WP_000079590.1.3649 WP_000079590.1.36495 WP_000079590.1.36512 WP_000079590.1.36526 WP_000079590.1.36542 WP_000079590.1.36547 WP_000079590.1.36564 WP_000079590.1.36567 WP_000079590.1.36579 WP_000079590.1.36584 WP_000079590.1.36592 WP_000079590.1.36617 WP_000079590.1.36618 WP_000079590.1.36643 WP_000079590.1.36663 WP_000079590.1.36685 WP_000079590.1.36701 WP_000079590.1.36721 WP_000079590.1.36725 WP_000079590.1.36764 WP_000079590.1.36765 WP_000079590.1.36779 WP_000079590.1.36792 WP_000079590.1.36798 WP_000079590.1.36802 WP_000079590.1.36821 WP_000079590.1.36853 WP_000079590.1.3688 WP_000079590.1.36885 WP_000079590.1.36889 WP_000079590.1.36949 WP_000079590.1.36950 WP_000079590.1.37013 WP_000079590.1.37014 WP_000079590.1.37021 WP_000079590.1.37029 WP_000079590.1.37100 WP_000079590.1.37114 WP_000079590.1.37119 WP_000079590.1.37133 WP_000079590.1.37147 WP_000079590.1.37158 WP_000079590.1.37176 WP_000079590.1.37191 WP_000079590.1.37199 WP_000079590.1.37200 WP_000079590.1.37258 WP_000079590.1.3726 WP_000079590.1.37267 WP_000079590.1.3728 WP_000079590.1.37297 WP_000079590.1.37303 WP_000079590.1.37320 WP_000079590.1.3734 WP_000079590.1.37363 WP_000079590.1.37405 WP_000079590.1.37478 WP_000079590.1.3748 WP_000079590.1.37513 WP_000079590.1.37521 WP_000079590.1.37584 WP_000079590.1.37590 WP_000079590.1.37593 WP_000079590.1.37600 WP_000079590.1.37610 WP_000079590.1.37613 WP_000079590.1.37659 WP_000079590.1.37662 WP_000079590.1.37675 WP_000079590.1.37687 WP_000079590.1.37691 WP_000079590.1.3771 WP_000079590.1.37719 WP_000079590.1.37761 WP_000079590.1.37775 WP_000079590.1.37777 WP_000079590.1.3778 WP_000079590.1.378 WP_000079590.1.37808 WP_000079590.1.37848 WP_000079590.1.37864 WP_000079590.1.379 WP_000079590.1.3790 WP_000079590.1.37911 WP_000079590.1.37941 WP_000079590.1.37965 WP_000079590.1.37985 WP_000079590.1.38026 WP_000079590.1.38037 WP_000079590.1.38047 WP_000079590.1.38055 WP_000079590.1.38061 WP_000079590.1.38064 WP_000079590.1.38108 WP_000079590.1.38113 WP_000079590.1.3816 WP_000079590.1.38207 WP_000079590.1.38261 WP_000079590.1.38266 WP_000079590.1.3828 WP_000079590.1.38310 WP_000079590.1.3834 WP_000079590.1.38341 WP_000079590.1.38344 WP_000079590.1.38351 WP_000079590.1.3838 WP_000079590.1.38381 WP_000079590.1.38393 WP_000079590.1.38440 WP_000079590.1.38486 WP_000079590.1.38515 WP_000079590.1.38569 WP_000079590.1.38595 WP_000079590.1.3860 WP_000079590.1.38642 WP_000079590.1.3869 WP_000079590.1.38734 WP_000079590.1.38740 WP_000079590.1.38781 WP_000079590.1.38797 WP_000079590.1.38857 WP_000079590.1.38877 WP_000079590.1.38983 WP_000079590.1.38995 WP_000079590.1.38996 WP_000079590.1.39048 WP_000079590.1.39055 WP_000079590.1.39056 WP_000079590.1.39065 WP_000079590.1.3907 WP_000079590.1.39105 WP_000079590.1.39113 WP_000079590.1.3914 WP_000079590.1.39140 WP_000079590.1.39147 WP_000079590.1.39161 WP_000079590.1.39183 WP_000079590.1.39210 WP_000079590.1.39235 WP_000079590.1.39265 WP_000079590.1.3931 WP_000079590.1.39312 WP_000079590.1.39395 WP_000079590.1.39414 WP_000079590.1.39435 WP_000079590.1.39466 WP_000079590.1.39471 WP_000079590.1.39497 WP_000079590.1.39502 WP_000079590.1.39503 WP_000079590.1.39530 WP_000079590.1.39556 WP_000079590.1.39584 WP_000079590.1.39609 WP_000079590.1.39614 WP_000079590.1.39619 WP_000079590.1.39620 WP_000079590.1.39624 WP_000079590.1.39632 WP_000079590.1.39659 WP_000079590.1.39667 WP_000079590.1.39722 WP_000079590.1.39724 WP_000079590.1.39775 WP_000079590.1.39879 WP_000079590.1.39890 WP_000079590.1.39941 WP_000079590.1.39947 WP_000079590.1.40008 WP_000079590.1.40081 WP_000079590.1.40095 WP_000079590.1.40097 WP_000079590.1.401 WP_000079590.1.40155 WP_000079590.1.40158 WP_000079590.1.40160 WP_000079590.1.40167 WP_000079590.1.40170 WP_000079590.1.40171 WP_000079590.1.40205 WP_000079590.1.40224 WP_000079590.1.40229 WP_000079590.1.40258 WP_000079590.1.40279 WP_000079590.1.40284 WP_000079590.1.40307 WP_000079590.1.40341 WP_000079590.1.40361 WP_000079590.1.4042 WP_000079590.1.40467 WP_000079590.1.40492 WP_000079590.1.40493 WP_000079590.1.40496 WP_000079590.1.40517 WP_000079590.1.40528 WP_000079590.1.40533 WP_000079590.1.40577 WP_000079590.1.40583 WP_000079590.1.40605 WP_000079590.1.40622 WP_000079590.1.40693 WP_000079590.1.40695 WP_000079590.1.40698 WP_000079590.1.40745 WP_000079590.1.40750 WP_000079590.1.40763 WP_000079590.1.40771 WP_000079590.1.40849 WP_000079590.1.40854 WP_000079590.1.4088 WP_000079590.1.4089 WP_000079590.1.40910 WP_000079590.1.40924 WP_000079590.1.40930 WP_000079590.1.40932 WP_000079590.1.40946 WP_000079590.1.40973 WP_000079590.1.40979 WP_000079590.1.40996 WP_000079590.1.41004 WP_000079590.1.41018 WP_000079590.1.41048 WP_000079590.1.41050 WP_000079590.1.4106 WP_000079590.1.41070 WP_000079590.1.41074 WP_000079590.1.41075 WP_000079590.1.4109 WP_000079590.1.41097 WP_000079590.1.41116 WP_000079590.1.41128 WP_000079590.1.41132 WP_000079590.1.41176 WP_000079590.1.41192 WP_000079590.1.41225 WP_000079590.1.41251 WP_000079590.1.41258 WP_000079590.1.41265 WP_000079590.1.41277 WP_000079590.1.41299 WP_000079590.1.41305 WP_000079590.1.41308 WP_000079590.1.41321 WP_000079590.1.41333 WP_000079590.1.41335 WP_000079590.1.4136 WP_000079590.1.41375 WP_000079590.1.4141 WP_000079590.1.41415 WP_000079590.1.41427 WP_000079590.1.41434 WP_000079590.1.41459 WP_000079590.1.41468 WP_000079590.1.41498 WP_000079590.1.41519 WP_000079590.1.41524 WP_000079590.1.41528 WP_000079590.1.41593 WP_000079590.1.41610 WP_000079590.1.41628 WP_000079590.1.41631 WP_000079590.1.41658 WP_000079590.1.41659 WP_000079590.1.41688 WP_000079590.1.41690 WP_000079590.1.41716 WP_000079590.1.41724 WP_000079590.1.41746 WP_000079590.1.41789 WP_000079590.1.41799 WP_000079590.1.41802 WP_000079590.1.41824 WP_000079590.1.41825 WP_000079590.1.41836 WP_000079590.1.4184 WP_000079590.1.41859 WP_000079590.1.41862 WP_000079590.1.41877 WP_000079590.1.41894 WP_000079590.1.41897 WP_000079590.1.41911 WP_000079590.1.41919 WP_000079590.1.41929 WP_000079590.1.41931 WP_000079590.1.41938 WP_000079590.1.4194 WP_000079590.1.41949 WP_000079590.1.41978 WP_000079590.1.41994 WP_000079590.1.41998 WP_000079590.1.42009 WP_000079590.1.42069 WP_000079590.1.42081 WP_000079590.1.42090 WP_000079590.1.42111 WP_000079590.1.42136 WP_000079590.1.42156 WP_000079590.1.42187 WP_000079590.1.422 WP_000079590.1.42200 WP_000079590.1.42219 WP_000079590.1.4222 WP_000079590.1.42238 WP_000079590.1.42243 WP_000079590.1.42257 WP_000079590.1.42261 WP_000079590.1.42263 WP_000079590.1.42276 WP_000079590.1.42322 WP_000079590.1.42328 WP_000079590.1.42349 WP_000079590.1.42356 WP_000079590.1.42364 WP_000079590.1.42371 WP_000079590.1.42379 WP_000079590.1.4239 WP_000079590.1.42391 WP_000079590.1.42392 WP_000079590.1.42394 WP_000079590.1.42399 WP_000079590.1.42404 WP_000079590.1.42444 WP_000079590.1.42453 WP_000079590.1.42489 WP_000079590.1.42491 WP_000079590.1.42539 WP_000079590.1.4257 WP_000079590.1.42595 WP_000079590.1.42603 WP_000079590.1.42650 WP_000079590.1.42666 WP_000079590.1.4267 WP_000079590.1.42675 WP_000079590.1.42676 WP_000079590.1.42683 WP_000079590.1.42701 WP_000079590.1.42707 WP_000079590.1.42734 WP_000079590.1.42805 WP_000079590.1.42815 WP_000079590.1.42859 WP_000079590.1.4289 WP_000079590.1.42892 WP_000079590.1.42932 WP_000079590.1.4298 WP_000079590.1.42981 WP_000079590.1.43008 WP_000079590.1.43016 WP_000079590.1.43019 WP_000079590.1.43065 WP_000079590.1.43068 WP_000079590.1.43069 WP_000079590.1.43077 WP_000079590.1.43089 WP_000079590.1.43126 WP_000079590.1.43128 WP_000079590.1.43141 WP_000079590.1.43157 WP_000079590.1.43161 WP_000079590.1.43190 WP_000079590.1.43198 WP_000079590.1.43201 WP_000079590.1.43258 WP_000079590.1.4326 WP_000079590.1.43272 WP_000079590.1.43276 WP_000079590.1.43290 WP_000079590.1.43292 WP_000079590.1.43299 WP_000079590.1.43307 WP_000079590.1.4332 WP_000079590.1.43339 WP_000079590.1.43351 WP_000079590.1.43371 WP_000079590.1.43438 WP_000079590.1.4344 WP_000079590.1.43441 WP_000079590.1.43508 WP_000079590.1.43513 WP_000079590.1.43633 WP_000079590.1.43637 WP_000079590.1.43651 WP_000079590.1.43654 WP_000079590.1.43676 WP_000079590.1.43685 WP_000079590.1.43710 WP_000079590.1.43711 WP_000079590.1.43722 WP_000079590.1.4373 WP_000079590.1.43763 WP_000079590.1.43778 WP_000079590.1.43782 WP_000079590.1.43785 WP_000079590.1.43801 WP_000079590.1.43812 WP_000079590.1.43828 WP_000079590.1.43864 WP_000079590.1.43873 WP_000079590.1.43878 WP_000079590.1.43888 WP_000079590.1.43919 WP_000079590.1.43951 WP_000079590.1.43954 WP_000079590.1.43974 WP_000079590.1.44010 WP_000079590.1.4404 WP_000079590.1.44049 WP_000079590.1.44063 WP_000079590.1.44101 WP_000079590.1.44113 WP_000079590.1.44160 WP_000079590.1.44180 WP_000079590.1.44187 WP_000079590.1.44191 WP_000079590.1.44196 WP_000079590.1.44208 WP_000079590.1.4422 WP_000079590.1.4423 WP_000079590.1.44248 WP_000079590.1.44262 WP_000079590.1.44268 WP_000079590.1.4427 WP_000079590.1.44296 WP_000079590.1.44300 WP_000079590.1.44337 WP_000079590.1.44339 WP_000079590.1.44343 WP_000079590.1.44351 WP_000079590.1.44359 WP_000079590.1.44360 WP_000079590.1.44380 WP_000079590.1.44397 WP_000079590.1.44416 WP_000079590.1.44431 WP_000079590.1.44433 WP_000079590.1.44437 WP_000079590.1.44453 WP_000079590.1.44474 WP_000079590.1.44546 WP_000079590.1.44549 WP_000079590.1.44593 WP_000079590.1.44636 WP_000079590.1.4468 WP_000079590.1.44702 WP_000079590.1.44705 WP_000079590.1.44762 WP_000079590.1.44791 WP_000079590.1.44795 WP_000079590.1.44815 WP_000079590.1.44828 WP_000079590.1.44831 WP_000079590.1.44879 WP_000079590.1.44887 WP_000079590.1.449 WP_000079590.1.44917 WP_000079590.1.44933 WP_000079590.1.44966 WP_000079590.1.44971 WP_000079590.1.44978 WP_000079590.1.44996 WP_000079590.1.44997 WP_000079590.1.4501 WP_000079590.1.45027 WP_000079590.1.45045 WP_000079590.1.45072 WP_000079590.1.45093 WP_000079590.1.45123 WP_000079590.1.45134 WP_000079590.1.45136 WP_000079590.1.45138 WP_000079590.1.45145 WP_000079590.1.45154 WP_000079590.1.45173 WP_000079590.1.45241 WP_000079590.1.45251 WP_000079590.1.45302 WP_000079590.1.4531 WP_000079590.1.45322 WP_000079590.1.45344 WP_000079590.1.45351 WP_000079590.1.4540 WP_000079590.1.45432 WP_000079590.1.45434 WP_000079590.1.45435 WP_000079590.1.45462 WP_000079590.1.45468 WP_000079590.1.45523 WP_000079590.1.45544 WP_000079590.1.45549 WP_000079590.1.45566 WP_000079590.1.45569 WP_000079590.1.45571 WP_000079590.1.45582 WP_000079590.1.45583 WP_000079590.1.45596 WP_000079590.1.45622 WP_000079590.1.45648 WP_000079590.1.45706 WP_000079590.1.45781 WP_000079590.1.45797 WP_000079590.1.45829 WP_000079590.1.45844 WP_000079590.1.45848 WP_000079590.1.45871 WP_000079590.1.45906 WP_000079590.1.45918 WP_000079590.1.4592 WP_000079590.1.46030 WP_000079590.1.46077 WP_000079590.1.46124 WP_000079590.1.46169 WP_000079590.1.46205 WP_000079590.1.46215 WP_000079590.1.46225 WP_000079590.1.46241 WP_000079590.1.46243 WP_000079590.1.46278 WP_000079590.1.46299 WP_000079590.1.46307 WP_000079590.1.46323 WP_000079590.1.46355 WP_000079590.1.46358 WP_000079590.1.464 WP_000079590.1.46434 WP_000079590.1.46454 WP_000079590.1.46461 WP_000079590.1.46504 WP_000079590.1.46505 WP_000079590.1.46551 WP_000079590.1.46559 WP_000079590.1.46572 WP_000079590.1.46578 WP_000079590.1.46637 WP_000079590.1.46693 WP_000079590.1.46701 WP_000079590.1.46726 WP_000079590.1.46732 WP_000079590.1.4674 WP_000079590.1.46781 WP_000079590.1.46816 WP_000079590.1.46842 WP_000079590.1.4686 WP_000079590.1.4690 WP_000079590.1.46920 WP_000079590.1.46930 WP_000079590.1.46945 WP_000079590.1.46967 WP_000079590.1.46975 WP_000079590.1.46976 WP_000079590.1.47005 WP_000079590.1.47008 WP_000079590.1.47014 WP_000079590.1.47036 WP_000079590.1.47037 WP_000079590.1.47042 WP_000079590.1.47059 WP_000079590.1.47085 WP_000079590.1.47123 WP_000079590.1.47215 WP_000079590.1.47245 WP_000079590.1.47442 WP_000079590.1.47460 WP_000079590.1.47492 WP_000079590.1.47506 WP_000079590.1.47507 WP_000079590.1.47523 WP_000079590.1.47531 WP_000079590.1.47532 WP_000079590.1.47567 WP_000079590.1.47576 WP_000079590.1.47579 WP_000079590.1.4758 WP_000079590.1.47605 WP_000079590.1.47614 WP_000079590.1.47630 WP_000079590.1.4769 WP_000079590.1.4770 WP_000079590.1.4774 WP_000079590.1.4775 WP_000079590.1.47756 WP_000079590.1.47767 WP_000079590.1.4781 WP_000079590.1.47829 WP_000079590.1.47849 WP_000079590.1.47850 WP_000079590.1.47875 WP_000079590.1.47886 WP_000079590.1.47898 WP_000079590.1.47902 WP_000079590.1.47911 WP_000079590.1.4795 WP_000079590.1.47988 WP_000079590.1.47992 WP_000079590.1.48019 WP_000079590.1.48100 WP_000079590.1.48114 WP_000079590.1.48139 WP_000079590.1.48190 WP_000079590.1.48215 WP_000079590.1.48218 WP_000079590.1.48244 WP_000079590.1.48247 WP_000079590.1.48268 WP_000079590.1.48292 WP_000079590.1.48324 WP_000079590.1.48342 WP_000079590.1.4839 WP_000079590.1.48399 WP_000079590.1.48426 WP_000079590.1.48430 WP_000079590.1.48436 WP_000079590.1.48524 WP_000079590.1.48586 WP_000079590.1.4859 WP_000079590.1.48591 WP_000079590.1.48610 WP_000079590.1.48631 WP_000079590.1.48663 WP_000079590.1.48690 WP_000079590.1.48734 WP_000079590.1.48751 WP_000079590.1.48755 WP_000079590.1.48756 WP_000079590.1.48774 WP_000079590.1.48778 WP_000079590.1.48797 WP_000079590.1.48849 WP_000079590.1.48855 WP_000079590.1.48896 WP_000079590.1.48908 WP_000079590.1.48955 WP_000079590.1.48963 WP_000079590.1.48973 WP_000079590.1.49004 WP_000079590.1.49012 WP_000079590.1.49090 WP_000079590.1.49106 WP_000079590.1.49113 WP_000079590.1.49117 WP_000079590.1.49121 WP_000079590.1.4914 WP_000079590.1.49140 WP_000079590.1.49153 WP_000079590.1.49162 WP_000079590.1.49166 WP_000079590.1.49214 WP_000079590.1.49262 WP_000079590.1.49309 WP_000079590.1.49311 WP_000079590.1.49334 WP_000079590.1.49355 WP_000079590.1.49429 WP_000079590.1.49434 WP_000079590.1.49450 WP_000079590.1.495 WP_000079590.1.49545 WP_000079590.1.49574 WP_000079590.1.49595 WP_000079590.1.49602 WP_000079590.1.49630 WP_000079590.1.49647 WP_000079590.1.49650 WP_000079590.1.49686 WP_000079590.1.49703 WP_000079590.1.49769 WP_000079590.1.49770 WP_000079590.1.49778 WP_000079590.1.49846 WP_000079590.1.49848 WP_000079590.1.4991 WP_000079590.1.49947 WP_000079590.1.49959 WP_000079590.1.49997 WP_000079590.1.50014 WP_000079590.1.50030 WP_000079590.1.50043 WP_000079590.1.50103 WP_000079590.1.50128 WP_000079590.1.50158 WP_000079590.1.50198 WP_000079590.1.50247 WP_000079590.1.50251 WP_000079590.1.50308 WP_000079590.1.50309 WP_000079590.1.50332 WP_000079590.1.50349 WP_000079590.1.50386 WP_000079590.1.50387 WP_000079590.1.50404 WP_000079590.1.50406 WP_000079590.1.50449 WP_000079590.1.50468 WP_000079590.1.50478 WP_000079590.1.5051 WP_000079590.1.50565 WP_000079590.1.50566 WP_000079590.1.50570 WP_000079590.1.5058 WP_000079590.1.50593 WP_000079590.1.50626 WP_000079590.1.50652 WP_000079590.1.50684 WP_000079590.1.50726 WP_000079590.1.50771 WP_000079590.1.50774 WP_000079590.1.50782 WP_000079590.1.50800 WP_000079590.1.50875 WP_000079590.1.50882 WP_000079590.1.50885 WP_000079590.1.509 WP_000079590.1.50905 WP_000079590.1.50929 WP_000079590.1.50954 WP_000079590.1.50960 WP_000079590.1.50970 WP_000079590.1.50999 WP_000079590.1.51036 WP_000079590.1.51040 WP_000079590.1.51048 WP_000079590.1.51066 WP_000079590.1.51100 WP_000079590.1.51117 WP_000079590.1.51131 WP_000079590.1.51134 WP_000079590.1.5114 WP_000079590.1.51224 WP_000079590.1.5125 WP_000079590.1.5127 WP_000079590.1.51305 WP_000079590.1.51315 WP_000079590.1.51331 WP_000079590.1.51338 WP_000079590.1.51356 WP_000079590.1.5136 WP_000079590.1.5138 WP_000079590.1.51394 WP_000079590.1.51419 WP_000079590.1.51451 WP_000079590.1.51474 WP_000079590.1.51502 WP_000079590.1.51506 WP_000079590.1.51518 WP_000079590.1.51519 WP_000079590.1.51598 WP_000079590.1.51613 WP_000079590.1.51642 WP_000079590.1.51644 WP_000079590.1.51704 WP_000079590.1.51724 WP_000079590.1.51734 WP_000079590.1.51764 WP_000079590.1.51810 WP_000079590.1.51831 WP_000079590.1.51838 WP_000079590.1.51863 WP_000079590.1.51868 WP_000079590.1.51900 WP_000079590.1.51910 WP_000079590.1.51914 WP_000079590.1.51930 WP_000079590.1.51935 WP_000079590.1.51994 WP_000079590.1.520 WP_000079590.1.52057 WP_000079590.1.5211 WP_000079590.1.52114 WP_000079590.1.52129 WP_000079590.1.52148 WP_000079590.1.52161 WP_000079590.1.52170 WP_000079590.1.52191 WP_000079590.1.52202 WP_000079590.1.52209 WP_000079590.1.52255 WP_000079590.1.52301 WP_000079590.1.52321 WP_000079590.1.52336 WP_000079590.1.52339 WP_000079590.1.52446 WP_000079590.1.52456 WP_000079590.1.52469 WP_000079590.1.52571 WP_000079590.1.52582 WP_000079590.1.52586 WP_000079590.1.526 WP_000079590.1.52637 WP_000079590.1.52647 WP_000079590.1.52692 WP_000079590.1.5273 WP_000079590.1.52738 WP_000079590.1.52742 WP_000079590.1.52744 WP_000079590.1.52773 WP_000079590.1.52795 WP_000079590.1.52807 WP_000079590.1.52833 WP_000079590.1.52858 WP_000079590.1.52866 WP_000079590.1.52887 WP_000079590.1.52924 WP_000079590.1.52949 WP_000079590.1.52985 WP_000079590.1.5301 WP_000079590.1.53092 WP_000079590.1.53100 WP_000079590.1.53107 WP_000079590.1.53119 WP_000079590.1.5313 WP_000079590.1.53141 WP_000079590.1.53151 WP_000079590.1.53154 WP_000079590.1.53158 WP_000079590.1.53159 WP_000079590.1.53179 WP_000079590.1.53198 WP_000079590.1.53210 WP_000079590.1.53233 WP_000079590.1.53234 WP_000079590.1.53272 WP_000079590.1.53274 WP_000079590.1.53286 WP_000079590.1.53307 WP_000079590.1.53315 WP_000079590.1.53316 WP_000079590.1.53321 WP_000079590.1.53328 WP_000079590.1.5333 WP_000079590.1.53362 WP_000079590.1.53368 WP_000079590.1.53375 WP_000079590.1.53385 WP_000079590.1.53436 WP_000079590.1.53450 WP_000079590.1.5349 WP_000079590.1.53540 WP_000079590.1.53555 WP_000079590.1.53559 WP_000079590.1.5356 WP_000079590.1.53567 WP_000079590.1.53571 WP_000079590.1.5358 WP_000079590.1.53664 WP_000079590.1.53675 WP_000079590.1.53692 WP_000079590.1.53696 WP_000079590.1.53723 WP_000079590.1.5374 WP_000079590.1.53750 WP_000079590.1.53772 WP_000079590.1.53778 WP_000079590.1.53781 WP_000079590.1.53790 WP_000079590.1.53800 WP_000079590.1.53814 WP_000079590.1.53815 WP_000079590.1.53839 WP_000079590.1.53892 WP_000079590.1.53896 WP_000079590.1.53898 WP_000079590.1.53902 WP_000079590.1.53905 WP_000079590.1.5392 WP_000079590.1.53958 WP_000079590.1.53961 WP_000079590.1.53981 WP_000079590.1.53984 WP_000079590.1.54068 WP_000079590.1.54085 WP_000079590.1.54132 WP_000079590.1.54136 WP_000079590.1.5415 WP_000079590.1.54170 WP_000079590.1.54175 WP_000079590.1.542 WP_000079590.1.54203 WP_000079590.1.54259 WP_000079590.1.54273 WP_000079590.1.54283 WP_000079590.1.5430 WP_000079590.1.54324 WP_000079590.1.54366 WP_000079590.1.54371 WP_000079590.1.54431 WP_000079590.1.54442 WP_000079590.1.54469 WP_000079590.1.54482 WP_000079590.1.54500 WP_000079590.1.54522 WP_000079590.1.54526 WP_000079590.1.54558 WP_000079590.1.5456 WP_000079590.1.54589 WP_000079590.1.54607 WP_000079590.1.54615 WP_000079590.1.54667 WP_000079590.1.54678 WP_000079590.1.54681 WP_000079590.1.54694 WP_000079590.1.54748 WP_000079590.1.54774 WP_000079590.1.5481 WP_000079590.1.54814 WP_000079590.1.54822 WP_000079590.1.54827 WP_000079590.1.54833 WP_000079590.1.54845 WP_000079590.1.5485 WP_000079590.1.54865 WP_000079590.1.54877 WP_000079590.1.5493 WP_000079590.1.54935 WP_000079590.1.54936 WP_000079590.1.54979 WP_000079590.1.54984 WP_000079590.1.54992 WP_000079590.1.55010 WP_000079590.1.55034 WP_000079590.1.55073 WP_000079590.1.55163 WP_000079590.1.55165 WP_000079590.1.55166 WP_000079590.1.55178 WP_000079590.1.55215 WP_000079590.1.55224 WP_000079590.1.55294 WP_000079590.1.55310 WP_000079590.1.55317 WP_000079590.1.55325 WP_000079590.1.55379 WP_000079590.1.5539 WP_000079590.1.55418 WP_000079590.1.55430 WP_000079590.1.55461 WP_000079590.1.55468 WP_000079590.1.55506 WP_000079590.1.5552 WP_000079590.1.55528 WP_000079590.1.55554 WP_000079590.1.55557 WP_000079590.1.55559 WP_000079590.1.5560 WP_000079590.1.55604 WP_000079590.1.55639 WP_000079590.1.55640 WP_000079590.1.55680 WP_000079590.1.55699 WP_000079590.1.5572 WP_000079590.1.55725 WP_000079590.1.5577 WP_000079590.1.55780 WP_000079590.1.55803 WP_000079590.1.55853 WP_000079590.1.55923 WP_000079590.1.55948 WP_000079590.1.55967 WP_000079590.1.55973 WP_000079590.1.55993 WP_000079590.1.55995 WP_000079590.1.56004 WP_000079590.1.56026 WP_000079590.1.56059 WP_000079590.1.56082 WP_000079590.1.56100 WP_000079590.1.56130 WP_000079590.1.56144 WP_000079590.1.56172 WP_000079590.1.5621 WP_000079590.1.56226 WP_000079590.1.56235 WP_000079590.1.56244 WP_000079590.1.56263 WP_000079590.1.56311 WP_000079590.1.5633 WP_000079590.1.56354 WP_000079590.1.56385 WP_000079590.1.56396 WP_000079590.1.56413 WP_000079590.1.56419 WP_000079590.1.56420 WP_000079590.1.56423 WP_000079590.1.56468 WP_000079590.1.56512 WP_000079590.1.56514 WP_000079590.1.56535 WP_000079590.1.56559 WP_000079590.1.56585 WP_000079590.1.56597 WP_000079590.1.56640 WP_000079590.1.56642 WP_000079590.1.56647 WP_000079590.1.56651 WP_000079590.1.56660 WP_000079590.1.5668 WP_000079590.1.56724 WP_000079590.1.56824 WP_000079590.1.56825 WP_000079590.1.56851 WP_000079590.1.56861 WP_000079590.1.56887 WP_000079590.1.56889 WP_000079590.1.56898 WP_000079590.1.56950 WP_000079590.1.56981 WP_000079590.1.57000 WP_000079590.1.57026 WP_000079590.1.57039 WP_000079590.1.57056 WP_000079590.1.57076 WP_000079590.1.57101 WP_000079590.1.5711 WP_000079590.1.57137 WP_000079590.1.57143 WP_000079590.1.57147 WP_000079590.1.57179 WP_000079590.1.57186 WP_000079590.1.57232 WP_000079590.1.57233 WP_000079590.1.57246 WP_000079590.1.57296 WP_000079590.1.57342 WP_000079590.1.57344 WP_000079590.1.57356 WP_000079590.1.57362 WP_000079590.1.57399 WP_000079590.1.57495 WP_000079590.1.57521 WP_000079590.1.5753 WP_000079590.1.57555 WP_000079590.1.57559 WP_000079590.1.57631 WP_000079590.1.57684 WP_000079590.1.57699 WP_000079590.1.57710 WP_000079590.1.5774 WP_000079590.1.57778 WP_000079590.1.57785 WP_000079590.1.57797 WP_000079590.1.57800 WP_000079590.1.5781 WP_000079590.1.57835 WP_000079590.1.57857 WP_000079590.1.57873 WP_000079590.1.57893 WP_000079590.1.57965 WP_000079590.1.57972 WP_000079590.1.58008 WP_000079590.1.58044 WP_000079590.1.58081 WP_000079590.1.5809 WP_000079590.1.58090 WP_000079590.1.58131 WP_000079590.1.58132 WP_000079590.1.58173 WP_000079590.1.58191 WP_000079590.1.58194 WP_000079590.1.58239 WP_000079590.1.58251 WP_000079590.1.58252 WP_000079590.1.58261 WP_000079590.1.58274 WP_000079590.1.5828 WP_000079590.1.58282 WP_000079590.1.58290 WP_000079590.1.58324 WP_000079590.1.58326 WP_000079590.1.58357 WP_000079590.1.58358 WP_000079590.1.5836 WP_000079590.1.58372 WP_000079590.1.58407 WP_000079590.1.58416 WP_000079590.1.58443 WP_000079590.1.58485 WP_000079590.1.58486 WP_000079590.1.58489 WP_000079590.1.58537 WP_000079590.1.5854 WP_000079590.1.58568 WP_000079590.1.58583 WP_000079590.1.58604 WP_000079590.1.58633 WP_000079590.1.58652 WP_000079590.1.58663 WP_000079590.1.58675 WP_000079590.1.587 WP_000079590.1.58724 WP_000079590.1.58729 WP_000079590.1.58744 WP_000079590.1.58749 WP_000079590.1.5875 WP_000079590.1.5878 WP_000079590.1.58796 WP_000079590.1.58807 WP_000079590.1.58831 WP_000079590.1.58834 WP_000079590.1.58847 WP_000079590.1.58861 WP_000079590.1.58883 WP_000079590.1.58884 WP_000079590.1.58898 WP_000079590.1.58926 WP_000079590.1.58949 WP_000079590.1.58963 WP_000079590.1.58970 WP_000079590.1.58974 WP_000079590.1.59006 WP_000079590.1.59012 WP_000079590.1.59020 WP_000079590.1.59043 WP_000079590.1.59056 WP_000079590.1.59061 WP_000079590.1.59064 WP_000079590.1.59084 WP_000079590.1.59136 WP_000079590.1.59142 WP_000079590.1.59148 WP_000079590.1.59163 WP_000079590.1.59282 WP_000079590.1.5929 WP_000079590.1.59295 WP_000079590.1.59299 WP_000079590.1.59313 WP_000079590.1.59335 WP_000079590.1.59420 WP_000079590.1.59427 WP_000079590.1.5949 WP_000079590.1.59501 WP_000079590.1.59510 WP_000079590.1.5953 WP_000079590.1.59538 WP_000079590.1.59548 WP_000079590.1.59562 WP_000079590.1.59636 WP_000079590.1.59646 WP_000079590.1.5969 WP_000079590.1.59751 WP_000079590.1.59755 WP_000079590.1.59827 WP_000079590.1.59829 WP_000079590.1.59847 WP_000079590.1.59848 WP_000079590.1.59863 WP_000079590.1.59969 WP_000079590.1.59979 WP_000079590.1.59994 WP_000079590.1.60045 WP_000079590.1.60076 WP_000079590.1.60114 WP_000079590.1.60126 WP_000079590.1.60137 WP_000079590.1.60154 WP_000079590.1.60168 WP_000079590.1.60192 WP_000079590.1.60199 WP_000079590.1.60209 WP_000079590.1.60212 WP_000079590.1.60213 WP_000079590.1.60231 WP_000079590.1.60253 WP_000079590.1.60320 WP_000079590.1.60322 WP_000079590.1.60324 WP_000079590.1.6033 WP_000079590.1.60330 WP_000079590.1.60356 WP_000079590.1.60370 WP_000079590.1.6038 WP_000079590.1.60380 WP_000079590.1.6041 WP_000079590.1.60424 WP_000079590.1.60425 WP_000079590.1.60481 WP_000079590.1.605 WP_000079590.1.60507 WP_000079590.1.60545 WP_000079590.1.60560 WP_000079590.1.60561 WP_000079590.1.6058 WP_000079590.1.60584 WP_000079590.1.60597 WP_000079590.1.6060 WP_000079590.1.60622 WP_000079590.1.60676 WP_000079590.1.60708 WP_000079590.1.60713 WP_000079590.1.60725 WP_000079590.1.60760 WP_000079590.1.60772 WP_000079590.1.60783 WP_000079590.1.60792 WP_000079590.1.608 WP_000079590.1.60807 WP_000079590.1.60851 WP_000079590.1.60855 WP_000079590.1.60857 WP_000079590.1.60863 WP_000079590.1.60866 WP_000079590.1.60882 WP_000079590.1.60889 WP_000079590.1.60897 WP_000079590.1.60918 WP_000079590.1.60926 WP_000079590.1.60950 WP_000079590.1.60990 WP_000079590.1.6104 WP_000079590.1.61044 WP_000079590.1.61076 WP_000079590.1.61087 WP_000079590.1.61114 WP_000079590.1.61123 WP_000079590.1.61146 WP_000079590.1.61147 WP_000079590.1.61168 WP_000079590.1.61184 WP_000079590.1.61200 WP_000079590.1.61210 WP_000079590.1.61218 WP_000079590.1.61356 WP_000079590.1.61357 WP_000079590.1.61381 WP_000079590.1.61434 WP_000079590.1.61501 WP_000079590.1.61511 WP_000079590.1.61519 WP_000079590.1.61539 WP_000079590.1.61542 WP_000079590.1.61553 WP_000079590.1.61594 WP_000079590.1.61595 WP_000079590.1.61609 WP_000079590.1.61649 WP_000079590.1.61652 WP_000079590.1.61662 WP_000079590.1.61667 WP_000079590.1.61671 WP_000079590.1.61697 WP_000079590.1.61732 WP_000079590.1.61783 WP_000079590.1.61809 WP_000079590.1.61877 WP_000079590.1.6190 WP_000079590.1.61908 WP_000079590.1.61920 WP_000079590.1.61924 WP_000079590.1.62020 WP_000079590.1.6209 WP_000079590.1.62108 WP_000079590.1.62124 WP_000079590.1.62144 WP_000079590.1.62158 WP_000079590.1.62184 WP_000079590.1.62199 WP_000079590.1.62201 WP_000079590.1.62210 WP_000079590.1.62223 WP_000079590.1.62245 WP_000079590.1.62257 WP_000079590.1.62271 WP_000079590.1.62310 WP_000079590.1.62314 WP_000079590.1.62323 WP_000079590.1.62333 WP_000079590.1.62338 WP_000079590.1.62339 WP_000079590.1.62344 WP_000079590.1.62380 WP_000079590.1.62404 WP_000079590.1.62411 WP_000079590.1.62412 WP_000079590.1.62436 WP_000079590.1.62475 WP_000079590.1.62504 WP_000079590.1.62536 WP_000079590.1.62564 WP_000079590.1.62570 WP_000079590.1.62619 WP_000079590.1.62640 WP_000079590.1.62677 WP_000079590.1.62686 WP_000079590.1.62693 WP_000079590.1.627 WP_000079590.1.62725 WP_000079590.1.62745 WP_000079590.1.62751 WP_000079590.1.62757 WP_000079590.1.62825 WP_000079590.1.62828 WP_000079590.1.62913 WP_000079590.1.6292 WP_000079590.1.62932 WP_000079590.1.62960 WP_000079590.1.62983 WP_000079590.1.62988 WP_000079590.1.63016 WP_000079590.1.63025 WP_000079590.1.63045 WP_000079590.1.63063 WP_000079590.1.63069 WP_000079590.1.63087 WP_000079590.1.63102 WP_000079590.1.63155 WP_000079590.1.63169 WP_000079590.1.63186 WP_000079590.1.63229 WP_000079590.1.63243 WP_000079590.1.63297 WP_000079590.1.63358 WP_000079590.1.63448 WP_000079590.1.63497 WP_000079590.1.63499 WP_000079590.1.63509 WP_000079590.1.63514 WP_000079590.1.63529 WP_000079590.1.63583 WP_000079590.1.63585 WP_000079590.1.63592 WP_000079590.1.63603 WP_000079590.1.63663 WP_000079590.1.6367 WP_000079590.1.63690 WP_000079590.1.6370 WP_000079590.1.63731 WP_000079590.1.63736 WP_000079590.1.63748 WP_000079590.1.63797 WP_000079590.1.63816 WP_000079590.1.63851 WP_000079590.1.63860 WP_000079590.1.63863 WP_000079590.1.63866 WP_000079590.1.63876 WP_000079590.1.6389 WP_000079590.1.63901 WP_000079590.1.63903 WP_000079590.1.63912 WP_000079590.1.63955 WP_000079590.1.63958 WP_000079590.1.63963 WP_000079590.1.63977 WP_000079590.1.64010 WP_000079590.1.64018 WP_000079590.1.64032 WP_000079590.1.64034 WP_000079590.1.64072 WP_000079590.1.64085 WP_000079590.1.64087 WP_000079590.1.64109 WP_000079590.1.64121 WP_000079590.1.6415 WP_000079590.1.64157 WP_000079590.1.64208 WP_000079590.1.64229 WP_000079590.1.64293 WP_000079590.1.64332 WP_000079590.1.64350 WP_000079590.1.64376 WP_000079590.1.64385 WP_000079590.1.64387 WP_000079590.1.644 WP_000079590.1.64462 WP_000079590.1.64471 WP_000079590.1.64500 WP_000079590.1.64501 WP_000079590.1.6451 WP_000079590.1.64538 WP_000079590.1.64597 WP_000079590.1.64632 WP_000079590.1.64648 WP_000079590.1.64654 WP_000079590.1.64662 WP_000079590.1.64663 WP_000079590.1.64674 WP_000079590.1.64690 WP_000079590.1.64709 WP_000079590.1.64710 WP_000079590.1.64711 WP_000079590.1.64744 WP_000079590.1.64763 WP_000079590.1.64798 WP_000079590.1.64817 WP_000079590.1.64847 WP_000079590.1.6487 WP_000079590.1.64891 WP_000079590.1.64894 WP_000079590.1.64919 WP_000079590.1.64944 WP_000079590.1.64972 WP_000079590.1.64974 WP_000079590.1.64977 WP_000079590.1.65011 WP_000079590.1.65054 WP_000079590.1.65075 WP_000079590.1.6514 WP_000079590.1.65168 WP_000079590.1.65172 WP_000079590.1.65191 WP_000079590.1.65200 WP_000079590.1.65211 WP_000079590.1.65218 WP_000079590.1.65226 WP_000079590.1.65238 WP_000079590.1.65249 WP_000079590.1.65266 WP_000079590.1.65269 WP_000079590.1.65357 WP_000079590.1.65394 WP_000079590.1.65395 WP_000079590.1.65459 WP_000079590.1.65463 WP_000079590.1.65487 WP_000079590.1.6549 WP_000079590.1.65499 WP_000079590.1.6550 WP_000079590.1.65508 WP_000079590.1.65538 WP_000079590.1.6554 WP_000079590.1.65572 WP_000079590.1.65601 WP_000079590.1.6561 WP_000079590.1.65650 WP_000079590.1.65697 WP_000079590.1.65698 WP_000079590.1.65699 WP_000079590.1.65755 WP_000079590.1.65771 WP_000079590.1.65790 WP_000079590.1.65812 WP_000079590.1.65846 WP_000079590.1.65849 WP_000079590.1.65863 WP_000079590.1.65881 WP_000079590.1.65883 WP_000079590.1.65901 WP_000079590.1.65940 WP_000079590.1.6595 WP_000079590.1.65956 WP_000079590.1.65968 WP_000079590.1.65985 WP_000079590.1.66021 WP_000079590.1.66031 WP_000079590.1.66049 WP_000079590.1.66052 WP_000079590.1.66064 WP_000079590.1.66085 WP_000079590.1.66109 WP_000079590.1.66122 WP_000079590.1.66129 WP_000079590.1.66145 WP_000079590.1.66171 WP_000079590.1.66183 WP_000079590.1.6620 WP_000079590.1.66216 WP_000079590.1.66234 WP_000079590.1.66250 WP_000079590.1.66272 WP_000079590.1.66273 WP_000079590.1.66289 WP_000079590.1.66315 WP_000079590.1.66324 WP_000079590.1.66330 WP_000079590.1.6634 WP_000079590.1.66361 WP_000079590.1.66365 WP_000079590.1.66385 WP_000079590.1.66400 WP_000079590.1.66428 WP_000079590.1.66446 WP_000079590.1.6647 WP_000079590.1.66480 WP_000079590.1.66506 WP_000079590.1.66539 WP_000079590.1.66665 WP_000079590.1.66678 WP_000079590.1.66681 WP_000079590.1.66684 WP_000079590.1.66702 WP_000079590.1.66733 WP_000079590.1.66755 WP_000079590.1.66759 WP_000079590.1.66779 WP_000079590.1.66801 WP_000079590.1.66824 WP_000079590.1.66860 WP_000079590.1.66876 WP_000079590.1.66937 WP_000079590.1.66953 WP_000079590.1.66955 WP_000079590.1.66959 WP_000079590.1.66981 WP_000079590.1.67 WP_000079590.1.67024 WP_000079590.1.67042 WP_000079590.1.67075 WP_000079590.1.6710 WP_000079590.1.67100 WP_000079590.1.67101 WP_000079590.1.67143 WP_000079590.1.67173 WP_000079590.1.67175 WP_000079590.1.67201 WP_000079590.1.67211 WP_000079590.1.67235 WP_000079590.1.67237 WP_000079590.1.67279 WP_000079590.1.67336 WP_000079590.1.67339 WP_000079590.1.67387 WP_000079590.1.6739 WP_000079590.1.67394 WP_000079590.1.67397 WP_000079590.1.67403 WP_000079590.1.67405 WP_000079590.1.67424 WP_000079590.1.67430 WP_000079590.1.67442 WP_000079590.1.67539 WP_000079590.1.67556 WP_000079590.1.67576 WP_000079590.1.6760 WP_000079590.1.67603 WP_000079590.1.67604 WP_000079590.1.67619 WP_000079590.1.67625 WP_000079590.1.67627 WP_000079590.1.67641 WP_000079590.1.67657 WP_000079590.1.67673 WP_000079590.1.67700 WP_000079590.1.67707 WP_000079590.1.67718 WP_000079590.1.67729 WP_000079590.1.67772 WP_000079590.1.67774 WP_000079590.1.67803 WP_000079590.1.67814 WP_000079590.1.6782 WP_000079590.1.67820 WP_000079590.1.67827 WP_000079590.1.67910 WP_000079590.1.67932 WP_000079590.1.67954 WP_000079590.1.67969 WP_000079590.1.67977 WP_000079590.1.68 WP_000079590.1.68043 WP_000079590.1.68075 WP_000079590.1.6809 WP_000079590.1.68105 WP_000079590.1.68113 WP_000079590.1.68115 WP_000079590.1.68131 WP_000079590.1.68140 WP_000079590.1.68147 WP_000079590.1.68159 WP_000079590.1.68182 WP_000079590.1.6819 WP_000079590.1.68210 WP_000079590.1.68285 WP_000079590.1.68359 WP_000079590.1.68401 WP_000079590.1.68420 WP_000079590.1.68477 WP_000079590.1.68478 WP_000079590.1.685 WP_000079590.1.68514 WP_000079590.1.68564 WP_000079590.1.6857 WP_000079590.1.68652 WP_000079590.1.68658 WP_000079590.1.68677 WP_000079590.1.68688 WP_000079590.1.68742 WP_000079590.1.68770 WP_000079590.1.68809 WP_000079590.1.6883 WP_000079590.1.68893 WP_000079590.1.68895 WP_000079590.1.68914 WP_000079590.1.68966 WP_000079590.1.68999 WP_000079590.1.69001 WP_000079590.1.69029 WP_000079590.1.6904 WP_000079590.1.6905 WP_000079590.1.69053 WP_000079590.1.69058 WP_000079590.1.69080 WP_000079590.1.69086 WP_000079590.1.69131 WP_000079590.1.69151 WP_000079590.1.69170 WP_000079590.1.69210 WP_000079590.1.69236 WP_000079590.1.69270 WP_000079590.1.69273 WP_000079590.1.69282 WP_000079590.1.69320 WP_000079590.1.69357 WP_000079590.1.69359 WP_000079590.1.69376 WP_000079590.1.69396 WP_000079590.1.69466 WP_000079590.1.69485 WP_000079590.1.69515 WP_000079590.1.6954 WP_000079590.1.69554 WP_000079590.1.69575 WP_000079590.1.69588 WP_000079590.1.69592 WP_000079590.1.69597 WP_000079590.1.69611 WP_000079590.1.69616 WP_000079590.1.69642 WP_000079590.1.69656 WP_000079590.1.69657 WP_000079590.1.69690 WP_000079590.1.69696 WP_000079590.1.69758 WP_000079590.1.69767 WP_000079590.1.69787 WP_000079590.1.69790 WP_000079590.1.69807 WP_000079590.1.69808 WP_000079590.1.69848 WP_000079590.1.69923 WP_000079590.1.69948 WP_000079590.1.69953 WP_000079590.1.69965 WP_000079590.1.69975 WP_000079590.1.69977 WP_000079590.1.69982 WP_000079590.1.70003 WP_000079590.1.70010 WP_000079590.1.70028 WP_000079590.1.70049 WP_000079590.1.70058 WP_000079590.1.70061 WP_000079590.1.70088 WP_000079590.1.70169 WP_000079590.1.70183 WP_000079590.1.70205 WP_000079590.1.70240 WP_000079590.1.70249 WP_000079590.1.70261 WP_000079590.1.70272 WP_000079590.1.70281 WP_000079590.1.70303 WP_000079590.1.70314 WP_000079590.1.70327 WP_000079590.1.7033 WP_000079590.1.70355 WP_000079590.1.70427 WP_000079590.1.70433 WP_000079590.1.7044 WP_000079590.1.70440 WP_000079590.1.70531 WP_000079590.1.70545 WP_000079590.1.70596 WP_000079590.1.70623 WP_000079590.1.70644 WP_000079590.1.70671 WP_000079590.1.70678 WP_000079590.1.70679 WP_000079590.1.70708 WP_000079590.1.70712 WP_000079590.1.70717 WP_000079590.1.70731 WP_000079590.1.70732 WP_000079590.1.70733 WP_000079590.1.70761 WP_000079590.1.70772 WP_000079590.1.70785 WP_000079590.1.70792 WP_000079590.1.70797 WP_000079590.1.70837 WP_000079590.1.70845 WP_000079590.1.70846 WP_000079590.1.70869 WP_000079590.1.70899 WP_000079590.1.70914 WP_000079590.1.7093 WP_000079590.1.70959 WP_000079590.1.70969 WP_000079590.1.70977 WP_000079590.1.70981 WP_000079590.1.70985 WP_000079590.1.70986 WP_000079590.1.70995 WP_000079590.1.71007 WP_000079590.1.71023 WP_000079590.1.71039 WP_000079590.1.71057 WP_000079590.1.71069 WP_000079590.1.71081 WP_000079590.1.71117 WP_000079590.1.71120 WP_000079590.1.71150 WP_000079590.1.71171 WP_000079590.1.71172 WP_000079590.1.71184 WP_000079590.1.71186 WP_000079590.1.71201 WP_000079590.1.71248 WP_000079590.1.71268 WP_000079590.1.71299 WP_000079590.1.71305 WP_000079590.1.7134 WP_000079590.1.71363 WP_000079590.1.714 WP_000079590.1.7142 WP_000079590.1.71450 WP_000079590.1.71455 WP_000079590.1.71456 WP_000079590.1.71487 WP_000079590.1.71523 WP_000079590.1.71542 WP_000079590.1.71566 WP_000079590.1.71583 WP_000079590.1.71600 WP_000079590.1.71626 WP_000079590.1.71636 WP_000079590.1.71640 WP_000079590.1.71649 WP_000079590.1.71651 WP_000079590.1.71653 WP_000079590.1.71658 WP_000079590.1.71691 WP_000079590.1.71716 WP_000079590.1.71798 WP_000079590.1.71872 WP_000079590.1.71929 WP_000079590.1.71950 WP_000079590.1.71954 WP_000079590.1.71979 WP_000079590.1.71984 WP_000079590.1.71985 WP_000079590.1.720 WP_000079590.1.72003 WP_000079590.1.72068 WP_000079590.1.72073 WP_000079590.1.72100 WP_000079590.1.72119 WP_000079590.1.72182 WP_000079590.1.72188 WP_000079590.1.72190 WP_000079590.1.72221 WP_000079590.1.72234 WP_000079590.1.72243 WP_000079590.1.72269 WP_000079590.1.72277 WP_000079590.1.72281 WP_000079590.1.72300 WP_000079590.1.72307 WP_000079590.1.72325 WP_000079590.1.72339 WP_000079590.1.72350 WP_000079590.1.72372 WP_000079590.1.72383 WP_000079590.1.72403 WP_000079590.1.72461 WP_000079590.1.72470 WP_000079590.1.72527 WP_000079590.1.72532 WP_000079590.1.7255 WP_000079590.1.72602 WP_000079590.1.72625 WP_000079590.1.72629 WP_000079590.1.72631 WP_000079590.1.72638 WP_000079590.1.72642 WP_000079590.1.72667 WP_000079590.1.72671 WP_000079590.1.72674 WP_000079590.1.72716 WP_000079590.1.72718 WP_000079590.1.72724 WP_000079590.1.72728 WP_000079590.1.72789 WP_000079590.1.72793 WP_000079590.1.72828 WP_000079590.1.72843 WP_000079590.1.72865 WP_000079590.1.72872 WP_000079590.1.72887 WP_000079590.1.72892 WP_000079590.1.72896 WP_000079590.1.72897 WP_000079590.1.7295 WP_000079590.1.72969 WP_000079590.1.72987 WP_000079590.1.7304 WP_000079590.1.73052 WP_000079590.1.73062 WP_000079590.1.73068 WP_000079590.1.7311 WP_000079590.1.73114 WP_000079590.1.73125 WP_000079590.1.7316 WP_000079590.1.73177 WP_000079590.1.73180 WP_000079590.1.73258 WP_000079590.1.73285 WP_000079590.1.7332 WP_000079590.1.7333 WP_000079590.1.73352 WP_000079590.1.73389 WP_000079590.1.7341 WP_000079590.1.73425 WP_000079590.1.73461 WP_000079590.1.73488 WP_000079590.1.73504 WP_000079590.1.73512 WP_000079590.1.7353 WP_000079590.1.73544 WP_000079590.1.73561 WP_000079590.1.73598 WP_000079590.1.7361 WP_000079590.1.73648 WP_000079590.1.73667 WP_000079590.1.73701 WP_000079590.1.73708 WP_000079590.1.73764 WP_000079590.1.73768 WP_000079590.1.73804 WP_000079590.1.73847 WP_000079590.1.73849 WP_000079590.1.7386 WP_000079590.1.73926 WP_000079590.1.73945 WP_000079590.1.73948 WP_000079590.1.73999 WP_000079590.1.74024 WP_000079590.1.74030 WP_000079590.1.74038 WP_000079590.1.74040 WP_000079590.1.74043 WP_000079590.1.74058 WP_000079590.1.74070 WP_000079590.1.74077 WP_000079590.1.74089 WP_000079590.1.74135 WP_000079590.1.74174 WP_000079590.1.74207 WP_000079590.1.74214 WP_000079590.1.74228 WP_000079590.1.74241 WP_000079590.1.74248 WP_000079590.1.74285 WP_000079590.1.743 WP_000079590.1.7430 WP_000079590.1.74300 WP_000079590.1.74317 WP_000079590.1.74414 WP_000079590.1.74415 WP_000079590.1.74418 WP_000079590.1.74422 WP_000079590.1.74454 WP_000079590.1.74469 WP_000079590.1.74481 WP_000079590.1.745 WP_000079590.1.74500 WP_000079590.1.74570 WP_000079590.1.74578 WP_000079590.1.74616 WP_000079590.1.74621 WP_000079590.1.74647 WP_000079590.1.74661 WP_000079590.1.74677 WP_000079590.1.74699 WP_000079590.1.74806 WP_000079590.1.74807 WP_000079590.1.74831 WP_000079590.1.74876 WP_000079590.1.74894 WP_000079590.1.7491 WP_000079590.1.74929 WP_000079590.1.74939 WP_000079590.1.74972 WP_000079590.1.74973 WP_000079590.1.75009 WP_000079590.1.75051 WP_000079590.1.75056 WP_000079590.1.7507 WP_000079590.1.75089 WP_000079590.1.75114 WP_000079590.1.75116 WP_000079590.1.75134 WP_000079590.1.75148 WP_000079590.1.75159 WP_000079590.1.75168 WP_000079590.1.75237 WP_000079590.1.75273 WP_000079590.1.75296 WP_000079590.1.75301 WP_000079590.1.7531 WP_000079590.1.75400 WP_000079590.1.75413 WP_000079590.1.7543 WP_000079590.1.75433 WP_000079590.1.75450 WP_000079590.1.75494 WP_000079590.1.75532 WP_000079590.1.75565 WP_000079590.1.7558 WP_000079590.1.75585 WP_000079590.1.75593 WP_000079590.1.75607 WP_000079590.1.75609 WP_000079590.1.75610 WP_000079590.1.75626 WP_000079590.1.75633 WP_000079590.1.75664 WP_000079590.1.75703 WP_000079590.1.75716 WP_000079590.1.75718 WP_000079590.1.75740 WP_000079590.1.75745 WP_000079590.1.75751 WP_000079590.1.75794 WP_000079590.1.75810 WP_000079590.1.75844 WP_000079590.1.75863 WP_000079590.1.75873 WP_000079590.1.75886 WP_000079590.1.75898 WP_000079590.1.75902 WP_000079590.1.75957 WP_000079590.1.76055 WP_000079590.1.76081 WP_000079590.1.76108 WP_000079590.1.76116 WP_000079590.1.76122 WP_000079590.1.76137 WP_000079590.1.76156 WP_000079590.1.76186 WP_000079590.1.76256 WP_000079590.1.7629 WP_000079590.1.76327 WP_000079590.1.76339 WP_000079590.1.7634 WP_000079590.1.76345 WP_000079590.1.76366 WP_000079590.1.76417 WP_000079590.1.76451 WP_000079590.1.7646 WP_000079590.1.76495 WP_000079590.1.76529 WP_000079590.1.76532 WP_000079590.1.76548 WP_000079590.1.76558 WP_000079590.1.7657 WP_000079590.1.76572 WP_000079590.1.76576 WP_000079590.1.76611 WP_000079590.1.76641 WP_000079590.1.76651 WP_000079590.1.76653 WP_000079590.1.7672 WP_000079590.1.76724 WP_000079590.1.76776 WP_000079590.1.76788 WP_000079590.1.76799 WP_000079590.1.7684 WP_000079590.1.76854 WP_000079590.1.76866 WP_000079590.1.76913 WP_000079590.1.76916 WP_000079590.1.76932 WP_000079590.1.76968 WP_000079590.1.76973 WP_000079590.1.76988 WP_000079590.1.77016 WP_000079590.1.77017 WP_000079590.1.77033 WP_000079590.1.77067 WP_000079590.1.77087 WP_000079590.1.77090 WP_000079590.1.77111 WP_000079590.1.77177 WP_000079590.1.77241 WP_000079590.1.77267 WP_000079590.1.77299 WP_000079590.1.77306 WP_000079590.1.77313 WP_000079590.1.77356 WP_000079590.1.77384 WP_000079590.1.77390 WP_000079590.1.77475 WP_000079590.1.77496 WP_000079590.1.77501 WP_000079590.1.77512 WP_000079590.1.77513 WP_000079590.1.77555 WP_000079590.1.77563 WP_000079590.1.77596 WP_000079590.1.77646 WP_000079590.1.77653 WP_000079590.1.77702 WP_000079590.1.77710 WP_000079590.1.77713 WP_000079590.1.7772 WP_000079590.1.77761 WP_000079590.1.77825 WP_000079590.1.77837 WP_000079590.1.77871 WP_000079590.1.77900 WP_000079590.1.7792 WP_000079590.1.77923 WP_000079590.1.7793 WP_000079590.1.77951 WP_000079590.1.77971 WP_000079590.1.77975 WP_000079590.1.77983 WP_000079590.1.77987 WP_000079590.1.77989 WP_000079590.1.78 WP_000079590.1.7802 WP_000079590.1.78026 WP_000079590.1.78035 WP_000079590.1.78048 WP_000079590.1.78051 WP_000079590.1.78107 WP_000079590.1.7814 WP_000079590.1.78166 WP_000079590.1.78168 WP_000079590.1.78180 WP_000079590.1.78192 WP_000079590.1.78195 WP_000079590.1.78291 WP_000079590.1.78301 WP_000079590.1.78309 WP_000079590.1.78320 WP_000079590.1.78339 WP_000079590.1.78366 WP_000079590.1.78372 WP_000079590.1.78382 WP_000079590.1.78388 WP_000079590.1.78410 WP_000079590.1.78443 WP_000079590.1.78495 WP_000079590.1.78496 WP_000079590.1.78501 WP_000079590.1.78502 WP_000079590.1.78603 WP_000079590.1.7862 WP_000079590.1.78626 WP_000079590.1.78632 WP_000079590.1.78658 WP_000079590.1.78661 WP_000079590.1.78674 WP_000079590.1.78676 WP_000079590.1.78697 WP_000079590.1.78734 WP_000079590.1.78738 WP_000079590.1.78761 WP_000079590.1.7877 WP_000079590.1.78771 WP_000079590.1.78789 WP_000079590.1.78815 WP_000079590.1.78838 WP_000079590.1.78862 WP_000079590.1.78877 WP_000079590.1.78881 WP_000079590.1.78896 WP_000079590.1.789 WP_000079590.1.7891 WP_000079590.1.78913 WP_000079590.1.78951 WP_000079590.1.78993 WP_000079590.1.79011 WP_000079590.1.79012 WP_000079590.1.79069 WP_000079590.1.79074 WP_000079590.1.79098 WP_000079590.1.79099 WP_000079590.1.79155 WP_000079590.1.79164 WP_000079590.1.79189 WP_000079590.1.79203 WP_000079590.1.79204 WP_000079590.1.79280 WP_000079590.1.79289 WP_000079590.1.79397 WP_000079590.1.794 WP_000079590.1.79427 WP_000079590.1.79456 WP_000079590.1.79466 WP_000079590.1.79468 WP_000079590.1.79532 WP_000079590.1.79547 WP_000079590.1.7956 WP_000079590.1.79580 WP_000079590.1.79586 WP_000079590.1.79645 WP_000079590.1.79654 WP_000079590.1.7970 WP_000079590.1.7972 WP_000079590.1.79722 WP_000079590.1.79734 WP_000079590.1.79738 WP_000079590.1.79757 WP_000079590.1.79772 WP_000079590.1.79778 WP_000079590.1.7982 WP_000079590.1.79832 WP_000079590.1.79867 WP_000079590.1.79880 WP_000079590.1.7991 WP_000079590.1.79910 WP_000079590.1.79916 WP_000079590.1.79929 WP_000079590.1.79934 WP_000079590.1.7994 WP_000079590.1.79942 WP_000079590.1.79951 WP_000079590.1.79974 WP_000079590.1.79996 WP_000079590.1.80065 WP_000079590.1.80103 WP_000079590.1.80149 WP_000079590.1.8024 WP_000079590.1.80249 WP_000079590.1.80250 WP_000079590.1.80254 WP_000079590.1.80273 WP_000079590.1.80282 WP_000079590.1.80293 WP_000079590.1.80307 WP_000079590.1.80354 WP_000079590.1.80368 WP_000079590.1.80380 WP_000079590.1.80386 WP_000079590.1.80400 WP_000079590.1.80441 WP_000079590.1.80462 WP_000079590.1.80473 WP_000079590.1.80480 WP_000079590.1.8049 WP_000079590.1.80492 WP_000079590.1.80496 WP_000079590.1.80569 WP_000079590.1.80609 WP_000079590.1.80629 WP_000079590.1.80651 WP_000079590.1.80664 WP_000079590.1.80696 WP_000079590.1.80707 WP_000079590.1.80725 WP_000079590.1.80741 WP_000079590.1.80757 WP_000079590.1.80760 WP_000079590.1.80827 WP_000079590.1.80857 WP_000079590.1.80868 WP_000079590.1.80874 WP_000079590.1.80876 WP_000079590.1.80913 WP_000079590.1.80959 WP_000079590.1.80973 WP_000079590.1.80984 WP_000079590.1.8106 WP_000079590.1.81107 WP_000079590.1.81109 WP_000079590.1.81110 WP_000079590.1.81118 WP_000079590.1.81131 WP_000079590.1.81187 WP_000079590.1.81197 WP_000079590.1.81225 WP_000079590.1.81262 WP_000079590.1.81268 WP_000079590.1.81269 WP_000079590.1.8127 WP_000079590.1.81271 WP_000079590.1.81275 WP_000079590.1.8130 WP_000079590.1.81302 WP_000079590.1.81305 WP_000079590.1.8131 WP_000079590.1.81328 WP_000079590.1.81333 WP_000079590.1.8134 WP_000079590.1.81342 WP_000079590.1.81364 WP_000079590.1.81388 WP_000079590.1.81404 WP_000079590.1.81410 WP_000079590.1.81455 WP_000079590.1.81494 WP_000079590.1.81504 WP_000079590.1.81528 WP_000079590.1.81557 WP_000079590.1.81668 WP_000079590.1.81676 WP_000079590.1.81681 WP_000079590.1.8170 WP_000079590.1.81727 WP_000079590.1.81735 WP_000079590.1.81736 WP_000079590.1.81743 WP_000079590.1.81760 WP_000079590.1.81763 WP_000079590.1.81768 WP_000079590.1.81855 WP_000079590.1.81921 WP_000079590.1.81931 WP_000079590.1.81936 WP_000079590.1.81941 WP_000079590.1.81949 WP_000079590.1.8196 WP_000079590.1.81977 WP_000079590.1.81995 WP_000079590.1.82037 WP_000079590.1.82070 WP_000079590.1.82076 WP_000079590.1.82099 WP_000079590.1.82131 WP_000079590.1.82141 WP_000079590.1.82144 WP_000079590.1.82149 WP_000079590.1.82156 WP_000079590.1.8218 WP_000079590.1.82180 WP_000079590.1.82192 WP_000079590.1.82201 WP_000079590.1.82214 WP_000079590.1.82225 WP_000079590.1.82232 WP_000079590.1.82269 WP_000079590.1.82347 WP_000079590.1.82352 WP_000079590.1.8240 WP_000079590.1.82401 WP_000079590.1.82408 WP_000079590.1.82416 WP_000079590.1.8242 WP_000079590.1.82420 WP_000079590.1.82456 WP_000079590.1.82464 WP_000079590.1.82465 WP_000079590.1.8247 WP_000079590.1.82473 WP_000079590.1.82474 WP_000079590.1.82530 WP_000079590.1.82553 WP_000079590.1.82569 WP_000079590.1.82570 WP_000079590.1.82637 WP_000079590.1.82646 WP_000079590.1.82648 WP_000079590.1.82670 WP_000079590.1.82731 WP_000079590.1.82763 WP_000079590.1.82812 WP_000079590.1.82850 WP_000079590.1.82872 WP_000079590.1.82886 WP_000079590.1.82899 WP_000079590.1.8294 WP_000079590.1.82946 WP_000079590.1.82959 WP_000079590.1.82964 WP_000079590.1.83005 WP_000079590.1.83006 WP_000079590.1.83007 WP_000079590.1.8304 WP_000079590.1.83139 WP_000079590.1.83180 WP_000079590.1.83204 WP_000079590.1.8322 WP_000079590.1.83229 WP_000079590.1.83235 WP_000079590.1.83247 WP_000079590.1.83258 WP_000079590.1.83290 WP_000079590.1.83331 WP_000079590.1.83333 WP_000079590.1.83354 WP_000079590.1.83356 WP_000079590.1.83360 WP_000079590.1.83365 WP_000079590.1.83378 WP_000079590.1.83388 WP_000079590.1.83510 WP_000079590.1.83558 WP_000079590.1.83598 WP_000079590.1.83657 WP_000079590.1.83677 WP_000079590.1.83710 WP_000079590.1.8375 WP_000079590.1.83923 WP_000079590.1.8399 WP_000079590.1.83994 WP_000079590.1.84 WP_000079590.1.84000 WP_000079590.1.84011 WP_000079590.1.84031 WP_000079590.1.8406 WP_000079590.1.84075 WP_000079590.1.84076 WP_000079590.1.84077 WP_000079590.1.84083 WP_000079590.1.84086 WP_000079590.1.84106 WP_000079590.1.84110 WP_000079590.1.84115 WP_000079590.1.84127 WP_000079590.1.84150 WP_000079590.1.84154 WP_000079590.1.84168 WP_000079590.1.84179 WP_000079590.1.84205 WP_000079590.1.84209 WP_000079590.1.84229 WP_000079590.1.84230 WP_000079590.1.8425 WP_000079590.1.84252 WP_000079590.1.84291 WP_000079590.1.84300 WP_000079590.1.8431 WP_000079590.1.84345 WP_000079590.1.84369 WP_000079590.1.84373 WP_000079590.1.84397 WP_000079590.1.84401 WP_000079590.1.84403 WP_000079590.1.84435 WP_000079590.1.84459 WP_000079590.1.84461 WP_000079590.1.84475 WP_000079590.1.84497 WP_000079590.1.84515 WP_000079590.1.84551 WP_000079590.1.84567 WP_000079590.1.84572 WP_000079590.1.84598 WP_000079590.1.84631 WP_000079590.1.84644 WP_000079590.1.84693 WP_000079590.1.84711 WP_000079590.1.84727 WP_000079590.1.84744 WP_000079590.1.84745 WP_000079590.1.84773 WP_000079590.1.84876 WP_000079590.1.849 WP_000079590.1.84945 WP_000079590.1.84967 WP_000079590.1.84983 WP_000079590.1.850 WP_000079590.1.85004 WP_000079590.1.8502 WP_000079590.1.85031 WP_000079590.1.85039 WP_000079590.1.85079 WP_000079590.1.85153 WP_000079590.1.85217 WP_000079590.1.8526 WP_000079590.1.85271 WP_000079590.1.85273 WP_000079590.1.85301 WP_000079590.1.85338 WP_000079590.1.85339 WP_000079590.1.8537 WP_000079590.1.85408 WP_000079590.1.85456 WP_000079590.1.85511 WP_000079590.1.85512 WP_000079590.1.85568 WP_000079590.1.8557 WP_000079590.1.85606 WP_000079590.1.85635 WP_000079590.1.85646 WP_000079590.1.85654 WP_000079590.1.85665 WP_000079590.1.85669 WP_000079590.1.85675 WP_000079590.1.85688 WP_000079590.1.85703 WP_000079590.1.85723 WP_000079590.1.85728 WP_000079590.1.85746 WP_000079590.1.85759 WP_000079590.1.85780 WP_000079590.1.85784 WP_000079590.1.85797 WP_000079590.1.85811 WP_000079590.1.85854 WP_000079590.1.85855 WP_000079590.1.85864 WP_000079590.1.859 WP_000079590.1.8591 WP_000079590.1.85917 WP_000079590.1.8594 WP_000079590.1.85943 WP_000079590.1.85977 WP_000079590.1.85982 WP_000079590.1.860 WP_000079590.1.86007 WP_000079590.1.86010 WP_000079590.1.86043 WP_000079590.1.8605 WP_000079590.1.86084 WP_000079590.1.86092 WP_000079590.1.8610 WP_000079590.1.86120 WP_000079590.1.86126 WP_000079590.1.86138 WP_000079590.1.8614 WP_000079590.1.86156 WP_000079590.1.86157 WP_000079590.1.86159 WP_000079590.1.8616 WP_000079590.1.86173 WP_000079590.1.86224 WP_000079590.1.86240 WP_000079590.1.86284 WP_000079590.1.86285 WP_000079590.1.86323 WP_000079590.1.86342 WP_000079590.1.86347 WP_000079590.1.86380 WP_000079590.1.8640 WP_000079590.1.8642 WP_000079590.1.86426 WP_000079590.1.86442 WP_000079590.1.8647 WP_000079590.1.86489 WP_000079590.1.86514 WP_000079590.1.86530 WP_000079590.1.86593 WP_000079590.1.86610 WP_000079590.1.86656 WP_000079590.1.86658 WP_000079590.1.86663 WP_000079590.1.8671 WP_000079590.1.86770 WP_000079590.1.86794 WP_000079590.1.86800 WP_000079590.1.86811 WP_000079590.1.86815 WP_000079590.1.8691 WP_000079590.1.86915 WP_000079590.1.86921 WP_000079590.1.86945 WP_000079590.1.86989 WP_000079590.1.87023 WP_000079590.1.87034 WP_000079590.1.87038 WP_000079590.1.87041 WP_000079590.1.87051 WP_000079590.1.87136 WP_000079590.1.87155 WP_000079590.1.87187 WP_000079590.1.87258 WP_000079590.1.87265 WP_000079590.1.87282 WP_000079590.1.87293 WP_000079590.1.87365 WP_000079590.1.87420 WP_000079590.1.87484 WP_000079590.1.87500 WP_000079590.1.87528 WP_000079590.1.87560 WP_000079590.1.87583 WP_000079590.1.8760 WP_000079590.1.87600 WP_000079590.1.87609 WP_000079590.1.87612 WP_000079590.1.87615 WP_000079590.1.87618 WP_000079590.1.87626 WP_000079590.1.87653 WP_000079590.1.87659 WP_000079590.1.87687 WP_000079590.1.87695 WP_000079590.1.87698 WP_000079590.1.87706 WP_000079590.1.87712 WP_000079590.1.87739 WP_000079590.1.87741 WP_000079590.1.87742 WP_000079590.1.87760 WP_000079590.1.87813 WP_000079590.1.87852 WP_000079590.1.87899 WP_000079590.1.87905 WP_000079590.1.8792 WP_000079590.1.87933 WP_000079590.1.87936 WP_000079590.1.87949 WP_000079590.1.87999 WP_000079590.1.8800 WP_000079590.1.88014 WP_000079590.1.88025 WP_000079590.1.88026 WP_000079590.1.8805 WP_000079590.1.88052 WP_000079590.1.8806 WP_000079590.1.88092 WP_000079590.1.881 WP_000079590.1.88136 WP_000079590.1.88145 WP_000079590.1.88165 WP_000079590.1.88174 WP_000079590.1.88185 WP_000079590.1.88199 WP_000079590.1.88214 WP_000079590.1.88222 WP_000079590.1.88244 WP_000079590.1.88275 WP_000079590.1.88299 WP_000079590.1.88313 WP_000079590.1.88356 WP_000079590.1.88359 WP_000079590.1.88407 WP_000079590.1.88414 WP_000079590.1.88423 WP_000079590.1.88444 WP_000079590.1.88446 WP_000079590.1.88458 WP_000079590.1.88474 WP_000079590.1.8849 WP_000079590.1.88501 WP_000079590.1.88508 WP_000079590.1.88538 WP_000079590.1.88547 WP_000079590.1.886 WP_000079590.1.88609 WP_000079590.1.88647 WP_000079590.1.88648 WP_000079590.1.88651 WP_000079590.1.88683 WP_000079590.1.88692 WP_000079590.1.88707 WP_000079590.1.88727 WP_000079590.1.88731 WP_000079590.1.88772 WP_000079590.1.88845 WP_000079590.1.88850 WP_000079590.1.88854 WP_000079590.1.8889 WP_000079590.1.88892 WP_000079590.1.88894 WP_000079590.1.88957 WP_000079590.1.88966 WP_000079590.1.88967 WP_000079590.1.88968 WP_000079590.1.88970 WP_000079590.1.88980 WP_000079590.1.88995 WP_000079590.1.88998 WP_000079590.1.89054 WP_000079590.1.89114 WP_000079590.1.89119 WP_000079590.1.89120 WP_000079590.1.89169 WP_000079590.1.89177 WP_000079590.1.89182 WP_000079590.1.89188 WP_000079590.1.89215 WP_000079590.1.89221 WP_000079590.1.89291 WP_000079590.1.89298 WP_000079590.1.89308 WP_000079590.1.89314 WP_000079590.1.89328 WP_000079590.1.89332 WP_000079590.1.89343 WP_000079590.1.89362 WP_000079590.1.89395 WP_000079590.1.8940 WP_000079590.1.89408 WP_000079590.1.89425 WP_000079590.1.89449 WP_000079590.1.89462 WP_000079590.1.8947 WP_000079590.1.89503 WP_000079590.1.89580 WP_000079590.1.89591 WP_000079590.1.89606 WP_000079590.1.8961 WP_000079590.1.89612 WP_000079590.1.89634 WP_000079590.1.89657 WP_000079590.1.89668 WP_000079590.1.89680 WP_000079590.1.89706 WP_000079590.1.89713 WP_000079590.1.89733 WP_000079590.1.89765 WP_000079590.1.89789 WP_000079590.1.89796 WP_000079590.1.89804 WP_000079590.1.89817 WP_000079590.1.89832 WP_000079590.1.89845 WP_000079590.1.89870 WP_000079590.1.89888 WP_000079590.1.89911 WP_000079590.1.8995 WP_000079590.1.89952 WP_000079590.1.89975 WP_000079590.1.90007 WP_000079590.1.9003 WP_000079590.1.90033 WP_000079590.1.9011 WP_000079590.1.90193 WP_000079590.1.90196 WP_000079590.1.90211 WP_000079590.1.90240 WP_000079590.1.90274 WP_000079590.1.90280 WP_000079590.1.90293 WP_000079590.1.90330 WP_000079590.1.90338 WP_000079590.1.90363 WP_000079590.1.90365 WP_000079590.1.90421 WP_000079590.1.90428 WP_000079590.1.90440 WP_000079590.1.90489 WP_000079590.1.90513 WP_000079590.1.90521 WP_000079590.1.90522 WP_000079590.1.90540 WP_000079590.1.90563 WP_000079590.1.90582 WP_000079590.1.90620 WP_000079590.1.90625 WP_000079590.1.9064 WP_000079590.1.90686 WP_000079590.1.90713 WP_000079590.1.90748 WP_000079590.1.90759 WP_000079590.1.90794 WP_000079590.1.90796 WP_000079590.1.90811 WP_000079590.1.90814 WP_000079590.1.90859 WP_000079590.1.9089 WP_000079590.1.9091 WP_000079590.1.9093 WP_000079590.1.90959 WP_000079590.1.90973 WP_000079590.1.90983 WP_000079590.1.90991 WP_000079590.1.91023 WP_000079590.1.91042 WP_000079590.1.91056 WP_000079590.1.91067 WP_000079590.1.91107 WP_000079590.1.91156 WP_000079590.1.91164 WP_000079590.1.91179 WP_000079590.1.91189 WP_000079590.1.91205 WP_000079590.1.91215 WP_000079590.1.91239 WP_000079590.1.91291 WP_000079590.1.9131 WP_000079590.1.91313 WP_000079590.1.9135 WP_000079590.1.9137 WP_000079590.1.91372 WP_000079590.1.91424 WP_000079590.1.91459 WP_000079590.1.91473 WP_000079590.1.91474 WP_000079590.1.91505 WP_000079590.1.91506 WP_000079590.1.91557 WP_000079590.1.91580 WP_000079590.1.91597 WP_000079590.1.91621 WP_000079590.1.91625 WP_000079590.1.91702 WP_000079590.1.91715 WP_000079590.1.91742 WP_000079590.1.91772 WP_000079590.1.91776 WP_000079590.1.91795 WP_000079590.1.91806 WP_000079590.1.91864 WP_000079590.1.9187 WP_000079590.1.91870 WP_000079590.1.91880 WP_000079590.1.91898 WP_000079590.1.91904 WP_000079590.1.91914 WP_000079590.1.91974 WP_000079590.1.92018 WP_000079590.1.92044 WP_000079590.1.92060 WP_000079590.1.92067 WP_000079590.1.92068 WP_000079590.1.92082 WP_000079590.1.92087 WP_000079590.1.92098 WP_000079590.1.92099 WP_000079590.1.92122 WP_000079590.1.92129 WP_000079590.1.92149 WP_000079590.1.92156 WP_000079590.1.92165 WP_000079590.1.92171 WP_000079590.1.92172 WP_000079590.1.92213 WP_000079590.1.9222 WP_000079590.1.92240 WP_000079590.1.92243 WP_000079590.1.92270 WP_000079590.1.92318 WP_000079590.1.92327 WP_000079590.1.92394 WP_000079590.1.92399 WP_000079590.1.92408 WP_000079590.1.92411 WP_000079590.1.92452 WP_000079590.1.92470 WP_000079590.1.92477 WP_000079590.1.9253 WP_000079590.1.92545 WP_000079590.1.92557 WP_000079590.1.92570 WP_000079590.1.92575 WP_000079590.1.92588 WP_000079590.1.926 WP_000079590.1.92628 WP_000079590.1.92633 WP_000079590.1.92649 WP_000079590.1.92676 WP_000079590.1.92705 WP_000079590.1.9271 WP_000079590.1.92734 WP_000079590.1.92754 WP_000079590.1.92758 WP_000079590.1.92806 WP_000079590.1.92810 WP_000079590.1.92823 WP_000079590.1.92827 WP_000079590.1.92832 WP_000079590.1.92836 WP_000079590.1.92843 WP_000079590.1.92879 WP_000079590.1.92890 WP_000079590.1.92893 WP_000079590.1.92929 WP_000079590.1.92987 WP_000079590.1.93007 WP_000079590.1.93022 WP_000079590.1.93059 WP_000079590.1.93076 WP_000079590.1.93103 WP_000079590.1.93105 WP_000079590.1.93111 WP_000079590.1.93121 WP_000079590.1.93168 WP_000079590.1.93184 WP_000079590.1.93215 WP_000079590.1.93221 WP_000079590.1.93223 WP_000079590.1.93239 WP_000079590.1.93275 WP_000079590.1.93302 WP_000079590.1.93339 WP_000079590.1.93350 WP_000079590.1.9336 WP_000079590.1.93376 WP_000079590.1.93387 WP_000079590.1.93410 WP_000079590.1.93469 WP_000079590.1.93511 WP_000079590.1.93512 WP_000079590.1.93524 WP_000079590.1.93577 WP_000079590.1.93635 WP_000079590.1.93657 WP_000079590.1.93671 WP_000079590.1.9374 WP_000079590.1.93741 WP_000079590.1.9375 WP_000079590.1.93754 WP_000079590.1.93780 WP_000079590.1.9380 WP_000079590.1.93809 WP_000079590.1.93828 WP_000079590.1.93842 WP_000079590.1.93843 WP_000079590.1.93875 WP_000079590.1.93909 WP_000079590.1.93919 WP_000079590.1.93937 WP_000079590.1.93938 WP_000079590.1.93984 WP_000079590.1.93986 WP_000079590.1.9399 WP_000079590.1.94017 WP_000079590.1.94056 WP_000079590.1.94079 WP_000079590.1.94097 WP_000079590.1.94107 WP_000079590.1.94132 WP_000079590.1.94142 WP_000079590.1.94181 WP_000079590.1.94215 WP_000079590.1.94303 WP_000079590.1.94365 WP_000079590.1.94379 WP_000079590.1.94390 WP_000079590.1.9440 WP_000079590.1.94415 WP_000079590.1.94473 WP_000079590.1.94492 WP_000079590.1.94510 WP_000079590.1.94527 WP_000079590.1.94562 WP_000079590.1.94573 WP_000079590.1.94579 WP_000079590.1.94586 WP_000079590.1.94588 WP_000079590.1.94593 WP_000079590.1.94598 WP_000079590.1.94622 WP_000079590.1.9463 WP_000079590.1.94649 WP_000079590.1.94650 WP_000079590.1.94655 WP_000079590.1.94659 WP_000079590.1.94662 WP_000079590.1.94669 WP_000079590.1.94670 WP_000079590.1.94700 WP_000079590.1.94717 WP_000079590.1.94745 WP_000079590.1.94782 WP_000079590.1.94785 WP_000079590.1.94798 WP_000079590.1.9481 WP_000079590.1.94815 WP_000079590.1.94820 WP_000079590.1.94835 WP_000079590.1.94849 WP_000079590.1.94850 WP_000079590.1.94851 WP_000079590.1.94862 WP_000079590.1.94864 WP_000079590.1.94921 WP_000079590.1.94952 WP_000079590.1.94971 WP_000079590.1.94983 WP_000079590.1.94986 WP_000079590.1.94987 WP_000079590.1.95006 WP_000079590.1.95055 WP_000079590.1.95076 WP_000079590.1.95099 WP_000079590.1.95136 WP_000079590.1.95152 WP_000079590.1.95165 WP_000079590.1.95235 WP_000079590.1.95239 WP_000079590.1.95246 WP_000079590.1.95248 WP_000079590.1.95249 WP_000079590.1.9525 WP_000079590.1.95255 WP_000079590.1.95265 WP_000079590.1.9527 WP_000079590.1.95277 WP_000079590.1.95289 WP_000079590.1.95298 WP_000079590.1.9530 WP_000079590.1.95320 WP_000079590.1.95338 WP_000079590.1.95388 WP_000079590.1.95404 WP_000079590.1.95412 WP_000079590.1.95434 WP_000079590.1.95447 WP_000079590.1.95456 WP_000079590.1.95530 WP_000079590.1.95547 WP_000079590.1.95558 WP_000079590.1.95590 WP_000079590.1.95607 WP_000079590.1.95623 WP_000079590.1.95625 WP_000079590.1.95641 WP_000079590.1.95656 WP_000079590.1.95670 WP_000079590.1.95675 WP_000079590.1.95691 WP_000079590.1.95701 WP_000079590.1.95703 WP_000079590.1.95716 WP_000079590.1.95729 WP_000079590.1.95757 WP_000079590.1.95776 WP_000079590.1.95803 WP_000079590.1.95826 WP_000079590.1.9586 WP_000079590.1.95866 WP_000079590.1.95884 WP_000079590.1.95890 WP_000079590.1.95901 WP_000079590.1.95906 WP_000079590.1.95939 WP_000079590.1.95940 WP_000079590.1.95963 WP_000079590.1.96004 WP_000079590.1.96025 WP_000079590.1.96042 WP_000079590.1.96044 WP_000079590.1.96045 WP_000079590.1.96094 WP_000079590.1.96107 WP_000079590.1.96127 WP_000079590.1.96144 WP_000079590.1.96162 WP_000079590.1.96172 WP_000079590.1.96188 WP_000079590.1.96203 WP_000079590.1.96211 WP_000079590.1.96212 WP_000079590.1.9624 WP_000079590.1.96260 WP_000079590.1.96319 WP_000079590.1.9633 WP_000079590.1.96340 WP_000079590.1.96348 WP_000079590.1.96349 WP_000079590.1.96359 WP_000079590.1.96380 WP_000079590.1.96404 WP_000079590.1.96429 WP_000079590.1.96490 WP_000079590.1.96497 WP_000079590.1.96521 WP_000079590.1.96533 WP_000079590.1.96537 WP_000079590.1.96539 WP_000079590.1.96552 WP_000079590.1.96584 WP_000079590.1.96588 WP_000079590.1.96600 WP_000079590.1.96610 WP_000079590.1.96625 WP_000079590.1.96635 WP_000079590.1.9664 WP_000079590.1.96642 WP_000079590.1.96662 WP_000079590.1.96675 WP_000079590.1.9670 WP_000079590.1.96735 WP_000079590.1.9674 WP_000079590.1.96750 WP_000079590.1.96758 WP_000079590.1.96761 WP_000079590.1.96792 WP_000079590.1.96801 WP_000079590.1.96803 WP_000079590.1.96876 WP_000079590.1.96890 WP_000079590.1.96925 WP_000079590.1.96938 WP_000079590.1.96946 WP_000079590.1.96957 WP_000079590.1.96978 WP_000079590.1.96993 WP_000079590.1.97005 WP_000079590.1.97026 WP_000079590.1.97028 WP_000079590.1.97047 WP_000079590.1.97079 WP_000079590.1.97089 WP_000079590.1.97103 WP_000079590.1.97143 WP_000079590.1.97154 WP_000079590.1.97184 WP_000079590.1.97185 WP_000079590.1.97224 WP_000079590.1.97287 WP_000079590.1.97291 WP_000079590.1.97297 WP_000079590.1.97322 WP_000079590.1.97328 WP_000079590.1.97337 WP_000079590.1.97368 WP_000079590.1.97386 WP_000079590.1.97413 WP_000079590.1.97422 WP_000079590.1.97441 WP_000079590.1.97477 WP_000079590.1.97487 WP_000079590.1.97496 WP_000079590.1.97497 WP_000079590.1.97505 WP_000079590.1.97534 WP_000079590.1.97547 WP_000079590.1.97599 WP_000079590.1.97606 WP_000079590.1.97615 WP_000079590.1.97626 WP_000079590.1.97631 WP_000079590.1.97640 WP_000079590.1.97646 WP_000079590.1.97648 WP_000079590.1.97656 WP_000079590.1.97690 WP_000079590.1.97691 WP_000079590.1.97704 WP_000079590.1.97726 WP_000079590.1.9774 WP_000079590.1.97772 WP_000079590.1.97819 WP_000079590.1.97840 WP_000079590.1.97873 WP_000079590.1.9793 WP_000079590.1.97938 WP_000079590.1.97981 WP_000079590.1.97983 WP_000079590.1.97986 WP_000079590.1.9799 WP_000079590.1.97991 WP_000079590.1.98036 WP_000079590.1.9805 WP_000079590.1.98080 WP_000079590.1.98086 WP_000079590.1.98107 WP_000079590.1.9811 WP_000079590.1.98119 WP_000079590.1.98124 WP_000079590.1.98158 WP_000079590.1.98170 WP_000079590.1.98236 WP_000079590.1.9826 WP_000079590.1.98263 WP_000079590.1.98338 WP_000079590.1.98392 WP_000079590.1.98418 WP_000079590.1.98438 WP_000079590.1.98440 WP_000079590.1.98448 WP_000079590.1.98457 WP_000079590.1.98472 WP_000079590.1.98483 WP_000079590.1.9850 WP_000079590.1.98502 WP_000079590.1.98570 WP_000079590.1.98607 WP_000079590.1.9863 WP_000079590.1.98726 WP_000079590.1.98731 WP_000079590.1.98751 WP_000079590.1.98762 WP_000079590.1.9877 WP_000079590.1.98779 WP_000079590.1.98801 WP_000079590.1.98818 WP_000079590.1.9887 WP_000079590.1.98931 WP_000079590.1.9899 WP_000079590.1.99057 WP_000079590.1.99083 WP_000079590.1.99097 WP_000079590.1.99107 WP_000079590.1.99163 WP_000079590.1.99164 WP_000079590.1.9919 WP_000079590.1.99197 WP_000079590.1.99198 WP_000079590.1.99215 WP_000079590.1.99278 WP_000079590.1.99335 WP_000079590.1.99339 WP_000079590.1.99350 WP_000079590.1.99360 WP_000079590.1.99363 WP_000079590.1.99369 WP_000079590.1.99370 WP_000079590.1.99388 WP_000079590.1.99397 WP_000079590.1.99456 WP_000079590.1.99463 WP_000079590.1.99469 WP_000079590.1.99483 WP_000079590.1.99490 WP_000079590.1.99493 WP_000079590.1.9954 WP_000079590.1.99546 WP_000079590.1.99561 WP_000079590.1.99577 WP_000079590.1.99579 WP_000079590.1.99595 WP_000079590.1.99613 WP_000079590.1.99626 WP_000079590.1.99630 WP_000079590.1.99637 WP_000079590.1.99671 WP_000079590.1.99676 WP_000079590.1.99747 WP_000079590.1.99764 WP_000079590.1.99829 WP_000079590.1.99837 WP_000079590.1.99841 WP_000079590.1.9992 WP_000079590.1.99924 WP_000079590.1.99961 WP_000079590.1.99996 gi|525827136|ref|YP_008249686.1| gi|529220125|ref|YP_008381314.1| gi|29142380|ref|NP_805722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]