SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16759867|ref|NP_455484.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16759867|ref|NP_455484.1|
Domain Number 1 Region: 1-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.9e-119
Family AAT-like 0.00000000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16759867|ref|NP_455484.1|
Sequence length 396
Comment aspartate aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MFENITAAPADPILGLADLFRADDRPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
TTKNYLGIDGIPEFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPV
KRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHSLDFEALQASLSEAQAGDVVLFHGC
CHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAALHKELIV
ASSYSKNFGLYNERVGACTLVAADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKDQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Download sequence
Identical sequences A0A2J9JWS7 A0A2K3A9T6 Q56114
gi|488654451|ref|YP_007926254.1| NP_455484.1.84458 WP_000462648.1.100008 WP_000462648.1.100036 WP_000462648.1.100079 WP_000462648.1.100196 WP_000462648.1.100284 WP_000462648.1.100313 WP_000462648.1.100314 WP_000462648.1.100321 WP_000462648.1.100354 WP_000462648.1.100421 WP_000462648.1.100432 WP_000462648.1.100446 WP_000462648.1.100450 WP_000462648.1.100592 WP_000462648.1.100610 WP_000462648.1.100732 WP_000462648.1.100733 WP_000462648.1.100739 WP_000462648.1.100764 WP_000462648.1.100799 WP_000462648.1.100941 WP_000462648.1.100953 WP_000462648.1.101011 WP_000462648.1.10108 WP_000462648.1.101226 WP_000462648.1.10124 WP_000462648.1.101271 WP_000462648.1.101312 WP_000462648.1.101322 WP_000462648.1.101374 WP_000462648.1.101616 WP_000462648.1.101890 WP_000462648.1.101941 WP_000462648.1.102050 WP_000462648.1.102087 WP_000462648.1.10338 WP_000462648.1.1038 WP_000462648.1.104 WP_000462648.1.10401 WP_000462648.1.10428 WP_000462648.1.10459 WP_000462648.1.10475 WP_000462648.1.10511 WP_000462648.1.10514 WP_000462648.1.10530 WP_000462648.1.10532 WP_000462648.1.10547 WP_000462648.1.10595 WP_000462648.1.10642 WP_000462648.1.10654 WP_000462648.1.10677 WP_000462648.1.10857 WP_000462648.1.10873 WP_000462648.1.10926 WP_000462648.1.10936 WP_000462648.1.11012 WP_000462648.1.11055 WP_000462648.1.11126 WP_000462648.1.11142 WP_000462648.1.11239 WP_000462648.1.11253 WP_000462648.1.11314 WP_000462648.1.11385 WP_000462648.1.1142 WP_000462648.1.11426 WP_000462648.1.11429 WP_000462648.1.11557 WP_000462648.1.11638 WP_000462648.1.11883 WP_000462648.1.11908 WP_000462648.1.11914 WP_000462648.1.12040 WP_000462648.1.12061 WP_000462648.1.1207 WP_000462648.1.12141 WP_000462648.1.12172 WP_000462648.1.12192 WP_000462648.1.1224 WP_000462648.1.12364 WP_000462648.1.12398 WP_000462648.1.12441 WP_000462648.1.12581 WP_000462648.1.12648 WP_000462648.1.12683 WP_000462648.1.12726 WP_000462648.1.12727 WP_000462648.1.12741 WP_000462648.1.12834 WP_000462648.1.13108 WP_000462648.1.13161 WP_000462648.1.1321 WP_000462648.1.13268 WP_000462648.1.13291 WP_000462648.1.133 WP_000462648.1.13314 WP_000462648.1.13338 WP_000462648.1.13342 WP_000462648.1.13352 WP_000462648.1.13406 WP_000462648.1.13440 WP_000462648.1.13443 WP_000462648.1.13476 WP_000462648.1.13599 WP_000462648.1.13686 WP_000462648.1.1372 WP_000462648.1.13732 WP_000462648.1.1382 WP_000462648.1.1397 WP_000462648.1.13972 WP_000462648.1.140 WP_000462648.1.1401 WP_000462648.1.1408 WP_000462648.1.14089 WP_000462648.1.14099 WP_000462648.1.14120 WP_000462648.1.14123 WP_000462648.1.14150 WP_000462648.1.14191 WP_000462648.1.14197 WP_000462648.1.14280 WP_000462648.1.14333 WP_000462648.1.14399 WP_000462648.1.14444 WP_000462648.1.14467 WP_000462648.1.14474 WP_000462648.1.14500 WP_000462648.1.14526 WP_000462648.1.14550 WP_000462648.1.14575 WP_000462648.1.14701 WP_000462648.1.14703 WP_000462648.1.14719 WP_000462648.1.1473 WP_000462648.1.14765 WP_000462648.1.14810 WP_000462648.1.14877 WP_000462648.1.14894 WP_000462648.1.14930 WP_000462648.1.14947 WP_000462648.1.14948 WP_000462648.1.15184 WP_000462648.1.15244 WP_000462648.1.15265 WP_000462648.1.15362 WP_000462648.1.15415 WP_000462648.1.15423 WP_000462648.1.15433 WP_000462648.1.15439 WP_000462648.1.15487 WP_000462648.1.15535 WP_000462648.1.15581 WP_000462648.1.15597 WP_000462648.1.15710 WP_000462648.1.15717 WP_000462648.1.15835 WP_000462648.1.15905 WP_000462648.1.15912 WP_000462648.1.15970 WP_000462648.1.16046 WP_000462648.1.16051 WP_000462648.1.16058 WP_000462648.1.16150 WP_000462648.1.16155 WP_000462648.1.1626 WP_000462648.1.16264 WP_000462648.1.16344 WP_000462648.1.16452 WP_000462648.1.16461 WP_000462648.1.16462 WP_000462648.1.16465 WP_000462648.1.16522 WP_000462648.1.16588 WP_000462648.1.16658 WP_000462648.1.16666 WP_000462648.1.16673 WP_000462648.1.1674 WP_000462648.1.16767 WP_000462648.1.16781 WP_000462648.1.16879 WP_000462648.1.16893 WP_000462648.1.16905 WP_000462648.1.16948 WP_000462648.1.17049 WP_000462648.1.17058 WP_000462648.1.17078 WP_000462648.1.17202 WP_000462648.1.17219 WP_000462648.1.1722 WP_000462648.1.17302 WP_000462648.1.17368 WP_000462648.1.17405 WP_000462648.1.17406 WP_000462648.1.17513 WP_000462648.1.17543 WP_000462648.1.17563 WP_000462648.1.17578 WP_000462648.1.17622 WP_000462648.1.17659 WP_000462648.1.17667 WP_000462648.1.17686 WP_000462648.1.17741 WP_000462648.1.17840 WP_000462648.1.17956 WP_000462648.1.18005 WP_000462648.1.1801 WP_000462648.1.18021 WP_000462648.1.18099 WP_000462648.1.18124 WP_000462648.1.18144 WP_000462648.1.18173 WP_000462648.1.18270 WP_000462648.1.18280 WP_000462648.1.18328 WP_000462648.1.18358 WP_000462648.1.18370 WP_000462648.1.18406 WP_000462648.1.18474 WP_000462648.1.18513 WP_000462648.1.18610 WP_000462648.1.18678 WP_000462648.1.18722 WP_000462648.1.18766 WP_000462648.1.1880 WP_000462648.1.1885 WP_000462648.1.18860 WP_000462648.1.18922 WP_000462648.1.18959 WP_000462648.1.19001 WP_000462648.1.19006 WP_000462648.1.19044 WP_000462648.1.19084 WP_000462648.1.19187 WP_000462648.1.19228 WP_000462648.1.19240 WP_000462648.1.19288 WP_000462648.1.19300 WP_000462648.1.19422 WP_000462648.1.19454 WP_000462648.1.19456 WP_000462648.1.19496 WP_000462648.1.19535 WP_000462648.1.19538 WP_000462648.1.19589 WP_000462648.1.19663 WP_000462648.1.19686 WP_000462648.1.19731 WP_000462648.1.19794 WP_000462648.1.1992 WP_000462648.1.19999 WP_000462648.1.20254 WP_000462648.1.20255 WP_000462648.1.20296 WP_000462648.1.20339 WP_000462648.1.2036 WP_000462648.1.20419 WP_000462648.1.20465 WP_000462648.1.20492 WP_000462648.1.2053 WP_000462648.1.20635 WP_000462648.1.20718 WP_000462648.1.2073 WP_000462648.1.20740 WP_000462648.1.20828 WP_000462648.1.2087 WP_000462648.1.20883 WP_000462648.1.20947 WP_000462648.1.20953 WP_000462648.1.21010 WP_000462648.1.2106 WP_000462648.1.21062 WP_000462648.1.21144 WP_000462648.1.21162 WP_000462648.1.21184 WP_000462648.1.21185 WP_000462648.1.21366 WP_000462648.1.21492 WP_000462648.1.2166 WP_000462648.1.21674 WP_000462648.1.21946 WP_000462648.1.21966 WP_000462648.1.22064 WP_000462648.1.22118 WP_000462648.1.22126 WP_000462648.1.2216 WP_000462648.1.22208 WP_000462648.1.2227 WP_000462648.1.22373 WP_000462648.1.22476 WP_000462648.1.22614 WP_000462648.1.22652 WP_000462648.1.22683 WP_000462648.1.2284 WP_000462648.1.22895 WP_000462648.1.22926 WP_000462648.1.22943 WP_000462648.1.22967 WP_000462648.1.23040 WP_000462648.1.23058 WP_000462648.1.23218 WP_000462648.1.2331 WP_000462648.1.2332 WP_000462648.1.23340 WP_000462648.1.2336 WP_000462648.1.23365 WP_000462648.1.23412 WP_000462648.1.23426 WP_000462648.1.23492 WP_000462648.1.23515 WP_000462648.1.23548 WP_000462648.1.23571 WP_000462648.1.23604 WP_000462648.1.23679 WP_000462648.1.23728 WP_000462648.1.2375 WP_000462648.1.23783 WP_000462648.1.23786 WP_000462648.1.23787 WP_000462648.1.23801 WP_000462648.1.24028 WP_000462648.1.24061 WP_000462648.1.24083 WP_000462648.1.24117 WP_000462648.1.24125 WP_000462648.1.24138 WP_000462648.1.24153 WP_000462648.1.24291 WP_000462648.1.24322 WP_000462648.1.24355 WP_000462648.1.24375 WP_000462648.1.24400 WP_000462648.1.24420 WP_000462648.1.24619 WP_000462648.1.24643 WP_000462648.1.24688 WP_000462648.1.24716 WP_000462648.1.2481 WP_000462648.1.24832 WP_000462648.1.24964 WP_000462648.1.25017 WP_000462648.1.25032 WP_000462648.1.25041 WP_000462648.1.25053 WP_000462648.1.25140 WP_000462648.1.25185 WP_000462648.1.25196 WP_000462648.1.25210 WP_000462648.1.25219 WP_000462648.1.25304 WP_000462648.1.25374 WP_000462648.1.25475 WP_000462648.1.25490 WP_000462648.1.25508 WP_000462648.1.25512 WP_000462648.1.25603 WP_000462648.1.2562 WP_000462648.1.25666 WP_000462648.1.25807 WP_000462648.1.25821 WP_000462648.1.25833 WP_000462648.1.25835 WP_000462648.1.25882 WP_000462648.1.25911 WP_000462648.1.25962 WP_000462648.1.25963 WP_000462648.1.26001 WP_000462648.1.26027 WP_000462648.1.26107 WP_000462648.1.2615 WP_000462648.1.26217 WP_000462648.1.26230 WP_000462648.1.26232 WP_000462648.1.26272 WP_000462648.1.26286 WP_000462648.1.26288 WP_000462648.1.26394 WP_000462648.1.26491 WP_000462648.1.2654 WP_000462648.1.26554 WP_000462648.1.26636 WP_000462648.1.26689 WP_000462648.1.2679 WP_000462648.1.26908 WP_000462648.1.2692 WP_000462648.1.26928 WP_000462648.1.270 WP_000462648.1.27008 WP_000462648.1.27027 WP_000462648.1.27070 WP_000462648.1.27077 WP_000462648.1.27086 WP_000462648.1.27087 WP_000462648.1.27111 WP_000462648.1.27115 WP_000462648.1.2713 WP_000462648.1.2717 WP_000462648.1.27228 WP_000462648.1.27282 WP_000462648.1.27285 WP_000462648.1.27329 WP_000462648.1.27361 WP_000462648.1.27565 WP_000462648.1.27595 WP_000462648.1.27598 WP_000462648.1.27706 WP_000462648.1.27775 WP_000462648.1.27785 WP_000462648.1.27900 WP_000462648.1.27928 WP_000462648.1.27945 WP_000462648.1.28004 WP_000462648.1.2809 WP_000462648.1.28155 WP_000462648.1.28198 WP_000462648.1.2822 WP_000462648.1.28229 WP_000462648.1.28384 WP_000462648.1.28386 WP_000462648.1.28395 WP_000462648.1.284 WP_000462648.1.2845 WP_000462648.1.28479 WP_000462648.1.28627 WP_000462648.1.28692 WP_000462648.1.2873 WP_000462648.1.28917 WP_000462648.1.28962 WP_000462648.1.29023 WP_000462648.1.29042 WP_000462648.1.2905 WP_000462648.1.2907 WP_000462648.1.29081 WP_000462648.1.29089 WP_000462648.1.29153 WP_000462648.1.29203 WP_000462648.1.29237 WP_000462648.1.29248 WP_000462648.1.29288 WP_000462648.1.29389 WP_000462648.1.29439 WP_000462648.1.2946 WP_000462648.1.29563 WP_000462648.1.29727 WP_000462648.1.29743 WP_000462648.1.29782 WP_000462648.1.29833 WP_000462648.1.2984 WP_000462648.1.29845 WP_000462648.1.29851 WP_000462648.1.29865 WP_000462648.1.29886 WP_000462648.1.29919 WP_000462648.1.2994 WP_000462648.1.29964 WP_000462648.1.29983 WP_000462648.1.30009 WP_000462648.1.30013 WP_000462648.1.3002 WP_000462648.1.30034 WP_000462648.1.30049 WP_000462648.1.30058 WP_000462648.1.30172 WP_000462648.1.30185 WP_000462648.1.30354 WP_000462648.1.30357 WP_000462648.1.30362 WP_000462648.1.3042 WP_000462648.1.30421 WP_000462648.1.30440 WP_000462648.1.30448 WP_000462648.1.30489 WP_000462648.1.30517 WP_000462648.1.30542 WP_000462648.1.30544 WP_000462648.1.30556 WP_000462648.1.30572 WP_000462648.1.30585 WP_000462648.1.30618 WP_000462648.1.30664 WP_000462648.1.30688 WP_000462648.1.30806 WP_000462648.1.30967 WP_000462648.1.31046 WP_000462648.1.31066 WP_000462648.1.31078 WP_000462648.1.31139 WP_000462648.1.31145 WP_000462648.1.31182 WP_000462648.1.31205 WP_000462648.1.3121 WP_000462648.1.31223 WP_000462648.1.3127 WP_000462648.1.31303 WP_000462648.1.3131 WP_000462648.1.31352 WP_000462648.1.31389 WP_000462648.1.31413 WP_000462648.1.31446 WP_000462648.1.31533 WP_000462648.1.31799 WP_000462648.1.31836 WP_000462648.1.31951 WP_000462648.1.32041 WP_000462648.1.32042 WP_000462648.1.3207 WP_000462648.1.32189 WP_000462648.1.32263 WP_000462648.1.32293 WP_000462648.1.32299 WP_000462648.1.32422 WP_000462648.1.32425 WP_000462648.1.32458 WP_000462648.1.32460 WP_000462648.1.32529 WP_000462648.1.32563 WP_000462648.1.32578 WP_000462648.1.32617 WP_000462648.1.3270 WP_000462648.1.32725 WP_000462648.1.32838 WP_000462648.1.32848 WP_000462648.1.32868 WP_000462648.1.3290 WP_000462648.1.32940 WP_000462648.1.32941 WP_000462648.1.3296 WP_000462648.1.32966 WP_000462648.1.32985 WP_000462648.1.33037 WP_000462648.1.3305 WP_000462648.1.33051 WP_000462648.1.33065 WP_000462648.1.33122 WP_000462648.1.3315 WP_000462648.1.33208 WP_000462648.1.33214 WP_000462648.1.33280 WP_000462648.1.33283 WP_000462648.1.33313 WP_000462648.1.33339 WP_000462648.1.33382 WP_000462648.1.33490 WP_000462648.1.33501 WP_000462648.1.33529 WP_000462648.1.33689 WP_000462648.1.3370 WP_000462648.1.33730 WP_000462648.1.33741 WP_000462648.1.33840 WP_000462648.1.3392 WP_000462648.1.33926 WP_000462648.1.33957 WP_000462648.1.33969 WP_000462648.1.34001 WP_000462648.1.34059 WP_000462648.1.34118 WP_000462648.1.34211 WP_000462648.1.34214 WP_000462648.1.34234 WP_000462648.1.34284 WP_000462648.1.34376 WP_000462648.1.34382 WP_000462648.1.34484 WP_000462648.1.34517 WP_000462648.1.34530 WP_000462648.1.34665 WP_000462648.1.34694 WP_000462648.1.34751 WP_000462648.1.34808 WP_000462648.1.34824 WP_000462648.1.34834 WP_000462648.1.34932 WP_000462648.1.34962 WP_000462648.1.35001 WP_000462648.1.35040 WP_000462648.1.35074 WP_000462648.1.35175 WP_000462648.1.35240 WP_000462648.1.35274 WP_000462648.1.35532 WP_000462648.1.35560 WP_000462648.1.3557 WP_000462648.1.35628 WP_000462648.1.3570 WP_000462648.1.35712 WP_000462648.1.35713 WP_000462648.1.35736 WP_000462648.1.35791 WP_000462648.1.35795 WP_000462648.1.35870 WP_000462648.1.35916 WP_000462648.1.35938 WP_000462648.1.35966 WP_000462648.1.36000 WP_000462648.1.36034 WP_000462648.1.36036 WP_000462648.1.36069 WP_000462648.1.36291 WP_000462648.1.36298 WP_000462648.1.36308 WP_000462648.1.36323 WP_000462648.1.36343 WP_000462648.1.36460 WP_000462648.1.3649 WP_000462648.1.36495 WP_000462648.1.36526 WP_000462648.1.36567 WP_000462648.1.36579 WP_000462648.1.36617 WP_000462648.1.36618 WP_000462648.1.36643 WP_000462648.1.36663 WP_000462648.1.36701 WP_000462648.1.36725 WP_000462648.1.36779 WP_000462648.1.36798 WP_000462648.1.36802 WP_000462648.1.36821 WP_000462648.1.36853 WP_000462648.1.36950 WP_000462648.1.37014 WP_000462648.1.37133 WP_000462648.1.37176 WP_000462648.1.37199 WP_000462648.1.37200 WP_000462648.1.37258 WP_000462648.1.37303 WP_000462648.1.37513 WP_000462648.1.37584 WP_000462648.1.37590 WP_000462648.1.37593 WP_000462648.1.37600 WP_000462648.1.37613 WP_000462648.1.37659 WP_000462648.1.37662 WP_000462648.1.37675 WP_000462648.1.37691 WP_000462648.1.37761 WP_000462648.1.37775 WP_000462648.1.37777 WP_000462648.1.378 WP_000462648.1.379 WP_000462648.1.37911 WP_000462648.1.37941 WP_000462648.1.37985 WP_000462648.1.38061 WP_000462648.1.38064 WP_000462648.1.38108 WP_000462648.1.3816 WP_000462648.1.38207 WP_000462648.1.38261 WP_000462648.1.38266 WP_000462648.1.38310 WP_000462648.1.3834 WP_000462648.1.38351 WP_000462648.1.3838 WP_000462648.1.38381 WP_000462648.1.38440 WP_000462648.1.38486 WP_000462648.1.38515 WP_000462648.1.38595 WP_000462648.1.3860 WP_000462648.1.38642 WP_000462648.1.38734 WP_000462648.1.38877 WP_000462648.1.38983 WP_000462648.1.38996 WP_000462648.1.39056 WP_000462648.1.3907 WP_000462648.1.39105 WP_000462648.1.3914 WP_000462648.1.39147 WP_000462648.1.39161 WP_000462648.1.39210 WP_000462648.1.39235 WP_000462648.1.3931 WP_000462648.1.39435 WP_000462648.1.39502 WP_000462648.1.39530 WP_000462648.1.39619 WP_000462648.1.39620 WP_000462648.1.39624 WP_000462648.1.39659 WP_000462648.1.39667 WP_000462648.1.39775 WP_000462648.1.39879 WP_000462648.1.39890 WP_000462648.1.39941 WP_000462648.1.39945 WP_000462648.1.39947 WP_000462648.1.40095 WP_000462648.1.40097 WP_000462648.1.401 WP_000462648.1.40160 WP_000462648.1.40167 WP_000462648.1.40279 WP_000462648.1.40361 WP_000462648.1.4042 WP_000462648.1.40467 WP_000462648.1.40496 WP_000462648.1.40517 WP_000462648.1.40698 WP_000462648.1.40750 WP_000462648.1.40763 WP_000462648.1.40854 WP_000462648.1.4089 WP_000462648.1.40924 WP_000462648.1.40932 WP_000462648.1.40946 WP_000462648.1.41004 WP_000462648.1.4106 WP_000462648.1.41070 WP_000462648.1.41074 WP_000462648.1.41075 WP_000462648.1.41097 WP_000462648.1.41132 WP_000462648.1.41176 WP_000462648.1.41251 WP_000462648.1.41258 WP_000462648.1.41305 WP_000462648.1.41321 WP_000462648.1.41333 WP_000462648.1.41335 WP_000462648.1.4136 WP_000462648.1.41415 WP_000462648.1.41459 WP_000462648.1.41498 WP_000462648.1.41519 WP_000462648.1.41631 WP_000462648.1.41658 WP_000462648.1.41659 WP_000462648.1.41716 WP_000462648.1.41746 WP_000462648.1.41824 WP_000462648.1.41825 WP_000462648.1.41836 WP_000462648.1.41894 WP_000462648.1.41919 WP_000462648.1.41929 WP_000462648.1.4194 WP_000462648.1.42069 WP_000462648.1.42081 WP_000462648.1.42090 WP_000462648.1.42111 WP_000462648.1.42187 WP_000462648.1.42200 WP_000462648.1.42219 WP_000462648.1.42257 WP_000462648.1.42261 WP_000462648.1.42349 WP_000462648.1.42364 WP_000462648.1.42371 WP_000462648.1.42379 WP_000462648.1.42391 WP_000462648.1.42399 WP_000462648.1.42539 WP_000462648.1.42603 WP_000462648.1.42650 WP_000462648.1.4267 WP_000462648.1.42701 WP_000462648.1.42805 WP_000462648.1.42815 WP_000462648.1.42859 WP_000462648.1.4298 WP_000462648.1.43008 WP_000462648.1.43016 WP_000462648.1.43019 WP_000462648.1.43065 WP_000462648.1.43068 WP_000462648.1.43069 WP_000462648.1.43128 WP_000462648.1.43141 WP_000462648.1.43157 WP_000462648.1.43161 WP_000462648.1.43190 WP_000462648.1.43198 WP_000462648.1.4326 WP_000462648.1.43290 WP_000462648.1.43292 WP_000462648.1.43307 WP_000462648.1.43513 WP_000462648.1.43633 WP_000462648.1.43637 WP_000462648.1.43651 WP_000462648.1.43722 WP_000462648.1.4373 WP_000462648.1.43801 WP_000462648.1.43812 WP_000462648.1.43878 WP_000462648.1.43888 WP_000462648.1.43919 WP_000462648.1.43974 WP_000462648.1.44049 WP_000462648.1.44101 WP_000462648.1.44160 WP_000462648.1.44180 WP_000462648.1.44196 WP_000462648.1.44248 WP_000462648.1.44262 WP_000462648.1.44268 WP_000462648.1.4427 WP_000462648.1.44296 WP_000462648.1.44343 WP_000462648.1.44351 WP_000462648.1.44360 WP_000462648.1.44416 WP_000462648.1.44431 WP_000462648.1.44437 WP_000462648.1.44546 WP_000462648.1.4468 WP_000462648.1.44762 WP_000462648.1.44815 WP_000462648.1.44828 WP_000462648.1.44879 WP_000462648.1.44917 WP_000462648.1.4501 WP_000462648.1.45072 WP_000462648.1.45093 WP_000462648.1.45136 WP_000462648.1.45241 WP_000462648.1.45435 WP_000462648.1.45522 WP_000462648.1.45523 WP_000462648.1.45596 WP_000462648.1.45648 WP_000462648.1.45829 WP_000462648.1.45871 WP_000462648.1.46030 WP_000462648.1.46077 WP_000462648.1.46169 WP_000462648.1.46225 WP_000462648.1.46241 WP_000462648.1.46307 WP_000462648.1.46355 WP_000462648.1.464 WP_000462648.1.46454 WP_000462648.1.46461 WP_000462648.1.46504 WP_000462648.1.46505 WP_000462648.1.46551 WP_000462648.1.46559 WP_000462648.1.46701 WP_000462648.1.46781 WP_000462648.1.46842 WP_000462648.1.4690 WP_000462648.1.46920 WP_000462648.1.46945 WP_000462648.1.47036 WP_000462648.1.47037 WP_000462648.1.47042 WP_000462648.1.47059 WP_000462648.1.47085 WP_000462648.1.47123 WP_000462648.1.47215 WP_000462648.1.47245 WP_000462648.1.47523 WP_000462648.1.47531 WP_000462648.1.47532 WP_000462648.1.47605 WP_000462648.1.47630 WP_000462648.1.4774 WP_000462648.1.47756 WP_000462648.1.4781 WP_000462648.1.47886 WP_000462648.1.47898 WP_000462648.1.48019 WP_000462648.1.48100 WP_000462648.1.48114 WP_000462648.1.48139 WP_000462648.1.48190 WP_000462648.1.48292 WP_000462648.1.48324 WP_000462648.1.48426 WP_000462648.1.48430 WP_000462648.1.48436 WP_000462648.1.48586 WP_000462648.1.4859 WP_000462648.1.48591 WP_000462648.1.48610 WP_000462648.1.48631 WP_000462648.1.48663 WP_000462648.1.48690 WP_000462648.1.48734 WP_000462648.1.48756 WP_000462648.1.48849 WP_000462648.1.48955 WP_000462648.1.48963 WP_000462648.1.48973 WP_000462648.1.49004 WP_000462648.1.49106 WP_000462648.1.49117 WP_000462648.1.49121 WP_000462648.1.4914 WP_000462648.1.49140 WP_000462648.1.49153 WP_000462648.1.49166 WP_000462648.1.49355 WP_000462648.1.49429 WP_000462648.1.49434 WP_000462648.1.49450 WP_000462648.1.495 WP_000462648.1.49545 WP_000462648.1.49703 WP_000462648.1.49769 WP_000462648.1.49827 WP_000462648.1.49846 WP_000462648.1.4991 WP_000462648.1.49947 WP_000462648.1.49959 WP_000462648.1.49997 WP_000462648.1.50014 WP_000462648.1.50030 WP_000462648.1.50043 WP_000462648.1.50103 WP_000462648.1.50158 WP_000462648.1.50247 WP_000462648.1.50308 WP_000462648.1.50309 WP_000462648.1.50387 WP_000462648.1.50406 WP_000462648.1.50468 WP_000462648.1.50566 WP_000462648.1.50570 WP_000462648.1.50626 WP_000462648.1.50726 WP_000462648.1.50771 WP_000462648.1.50875 WP_000462648.1.50885 WP_000462648.1.509 WP_000462648.1.50929 WP_000462648.1.50970 WP_000462648.1.51040 WP_000462648.1.51048 WP_000462648.1.51100 WP_000462648.1.51134 WP_000462648.1.51227 WP_000462648.1.5127 WP_000462648.1.51305 WP_000462648.1.51315 WP_000462648.1.5136 WP_000462648.1.51474 WP_000462648.1.51519 WP_000462648.1.51598 WP_000462648.1.51644 WP_000462648.1.51724 WP_000462648.1.51734 WP_000462648.1.51838 WP_000462648.1.51863 WP_000462648.1.51935 WP_000462648.1.52057 WP_000462648.1.52114 WP_000462648.1.52129 WP_000462648.1.52191 WP_000462648.1.52202 WP_000462648.1.52209 WP_000462648.1.52255 WP_000462648.1.52339 WP_000462648.1.52469 WP_000462648.1.52571 WP_000462648.1.526 WP_000462648.1.52647 WP_000462648.1.52742 WP_000462648.1.52773 WP_000462648.1.52795 WP_000462648.1.52807 WP_000462648.1.52887 WP_000462648.1.53092 WP_000462648.1.53141 WP_000462648.1.53151 WP_000462648.1.53154 WP_000462648.1.53159 WP_000462648.1.53210 WP_000462648.1.53233 WP_000462648.1.53307 WP_000462648.1.53321 WP_000462648.1.53368 WP_000462648.1.53375 WP_000462648.1.53450 WP_000462648.1.5349 WP_000462648.1.53540 WP_000462648.1.53555 WP_000462648.1.53559 WP_000462648.1.5356 WP_000462648.1.53571 WP_000462648.1.5358 WP_000462648.1.53692 WP_000462648.1.53723 WP_000462648.1.5374 WP_000462648.1.53750 WP_000462648.1.53800 WP_000462648.1.53815 WP_000462648.1.53839 WP_000462648.1.53892 WP_000462648.1.53898 WP_000462648.1.53902 WP_000462648.1.53958 WP_000462648.1.53981 WP_000462648.1.53984 WP_000462648.1.54132 WP_000462648.1.54170 WP_000462648.1.54175 WP_000462648.1.54203 WP_000462648.1.54259 WP_000462648.1.5430 WP_000462648.1.54371 WP_000462648.1.54431 WP_000462648.1.54442 WP_000462648.1.54482 WP_000462648.1.54589 WP_000462648.1.54667 WP_000462648.1.54678 WP_000462648.1.54681 WP_000462648.1.54748 WP_000462648.1.5481 WP_000462648.1.54865 WP_000462648.1.54935 WP_000462648.1.54979 WP_000462648.1.55010 WP_000462648.1.55034 WP_000462648.1.55163 WP_000462648.1.55165 WP_000462648.1.55178 WP_000462648.1.55215 WP_000462648.1.55290 WP_000462648.1.55310 WP_000462648.1.55317 WP_000462648.1.55379 WP_000462648.1.5539 WP_000462648.1.55468 WP_000462648.1.55506 WP_000462648.1.55604 WP_000462648.1.55639 WP_000462648.1.55699 WP_000462648.1.55725 WP_000462648.1.55780 WP_000462648.1.55967 WP_000462648.1.56144 WP_000462648.1.56172 WP_000462648.1.5621 WP_000462648.1.56226 WP_000462648.1.56311 WP_000462648.1.56419 WP_000462648.1.56423 WP_000462648.1.56514 WP_000462648.1.56535 WP_000462648.1.56585 WP_000462648.1.56640 WP_000462648.1.56724 WP_000462648.1.56825 WP_000462648.1.56887 WP_000462648.1.56889 WP_000462648.1.56981 WP_000462648.1.57101 WP_000462648.1.57137 WP_000462648.1.57147 WP_000462648.1.57179 WP_000462648.1.57186 WP_000462648.1.57684 WP_000462648.1.57699 WP_000462648.1.57785 WP_000462648.1.57800 WP_000462648.1.57873 WP_000462648.1.57965 WP_000462648.1.57972 WP_000462648.1.58008 WP_000462648.1.58044 WP_000462648.1.58081 WP_000462648.1.5809 WP_000462648.1.58132 WP_000462648.1.58173 WP_000462648.1.58191 WP_000462648.1.58194 WP_000462648.1.58252 WP_000462648.1.58261 WP_000462648.1.58274 WP_000462648.1.58282 WP_000462648.1.58324 WP_000462648.1.58326 WP_000462648.1.5836 WP_000462648.1.58485 WP_000462648.1.58537 WP_000462648.1.58568 WP_000462648.1.58652 WP_000462648.1.58663 WP_000462648.1.58724 WP_000462648.1.5875 WP_000462648.1.58796 WP_000462648.1.58807 WP_000462648.1.58831 WP_000462648.1.58847 WP_000462648.1.58883 WP_000462648.1.58898 WP_000462648.1.58949 WP_000462648.1.58963 WP_000462648.1.58970 WP_000462648.1.58974 WP_000462648.1.59020 WP_000462648.1.59043 WP_000462648.1.59056 WP_000462648.1.59061 WP_000462648.1.59064 WP_000462648.1.59282 WP_000462648.1.59299 WP_000462648.1.59313 WP_000462648.1.5949 WP_000462648.1.59501 WP_000462648.1.59510 WP_000462648.1.5969 WP_000462648.1.59751 WP_000462648.1.59827 WP_000462648.1.59829 WP_000462648.1.59847 WP_000462648.1.59863 WP_000462648.1.59969 WP_000462648.1.59994 WP_000462648.1.60045 WP_000462648.1.60076 WP_000462648.1.60114 WP_000462648.1.60154 WP_000462648.1.60168 WP_000462648.1.60192 WP_000462648.1.60199 WP_000462648.1.60212 WP_000462648.1.60253 WP_000462648.1.60322 WP_000462648.1.60324 WP_000462648.1.60356 WP_000462648.1.6038 WP_000462648.1.60380 WP_000462648.1.6041 WP_000462648.1.60424 WP_000462648.1.60481 WP_000462648.1.605 WP_000462648.1.6058 WP_000462648.1.60584 WP_000462648.1.6060 WP_000462648.1.60676 WP_000462648.1.60708 WP_000462648.1.60725 WP_000462648.1.60783 WP_000462648.1.60792 WP_000462648.1.60807 WP_000462648.1.60855 WP_000462648.1.60882 WP_000462648.1.60889 WP_000462648.1.60950 WP_000462648.1.6104 WP_000462648.1.61044 WP_000462648.1.61076 WP_000462648.1.61123 WP_000462648.1.61146 WP_000462648.1.61147 WP_000462648.1.61168 WP_000462648.1.61210 WP_000462648.1.61357 WP_000462648.1.61511 WP_000462648.1.61539 WP_000462648.1.61542 WP_000462648.1.61553 WP_000462648.1.61649 WP_000462648.1.61652 WP_000462648.1.61697 WP_000462648.1.61809 WP_000462648.1.61877 WP_000462648.1.61920 WP_000462648.1.62124 WP_000462648.1.62199 WP_000462648.1.62223 WP_000462648.1.62302 WP_000462648.1.62314 WP_000462648.1.62323 WP_000462648.1.62338 WP_000462648.1.62344 WP_000462648.1.62380 WP_000462648.1.62411 WP_000462648.1.62436 WP_000462648.1.62475 WP_000462648.1.62536 WP_000462648.1.62640 WP_000462648.1.62686 WP_000462648.1.62751 WP_000462648.1.62825 WP_000462648.1.62913 WP_000462648.1.62932 WP_000462648.1.62960 WP_000462648.1.63016 WP_000462648.1.63025 WP_000462648.1.63069 WP_000462648.1.63087 WP_000462648.1.63169 WP_000462648.1.63297 WP_000462648.1.63448 WP_000462648.1.63514 WP_000462648.1.63583 WP_000462648.1.63592 WP_000462648.1.63663 WP_000462648.1.63736 WP_000462648.1.63816 WP_000462648.1.63876 WP_000462648.1.6389 WP_000462648.1.63901 WP_000462648.1.63955 WP_000462648.1.63963 WP_000462648.1.64032 WP_000462648.1.64087 WP_000462648.1.6415 WP_000462648.1.64293 WP_000462648.1.64332 WP_000462648.1.64376 WP_000462648.1.644 WP_000462648.1.64471 WP_000462648.1.64501 WP_000462648.1.64538 WP_000462648.1.64632 WP_000462648.1.64648 WP_000462648.1.64662 WP_000462648.1.64663 WP_000462648.1.64709 WP_000462648.1.64710 WP_000462648.1.64744 WP_000462648.1.64763 WP_000462648.1.64817 WP_000462648.1.64847 WP_000462648.1.6487 WP_000462648.1.64891 WP_000462648.1.64974 WP_000462648.1.65054 WP_000462648.1.65075 WP_000462648.1.6514 WP_000462648.1.65172 WP_000462648.1.65191 WP_000462648.1.65200 WP_000462648.1.65211 WP_000462648.1.65218 WP_000462648.1.65226 WP_000462648.1.65249 WP_000462648.1.65266 WP_000462648.1.65394 WP_000462648.1.65395 WP_000462648.1.65459 WP_000462648.1.65463 WP_000462648.1.65487 WP_000462648.1.6549 WP_000462648.1.65499 WP_000462648.1.6554 WP_000462648.1.65650 WP_000462648.1.65697 WP_000462648.1.65699 WP_000462648.1.65737 WP_000462648.1.65755 WP_000462648.1.65790 WP_000462648.1.65812 WP_000462648.1.65846 WP_000462648.1.65863 WP_000462648.1.65985 WP_000462648.1.66021 WP_000462648.1.66031 WP_000462648.1.66052 WP_000462648.1.66064 WP_000462648.1.66109 WP_000462648.1.66145 WP_000462648.1.66183 WP_000462648.1.6620 WP_000462648.1.66216 WP_000462648.1.66234 WP_000462648.1.66273 WP_000462648.1.66324 WP_000462648.1.6634 WP_000462648.1.66361 WP_000462648.1.66480 WP_000462648.1.66506 WP_000462648.1.66665 WP_000462648.1.66681 WP_000462648.1.66684 WP_000462648.1.66755 WP_000462648.1.66759 WP_000462648.1.66801 WP_000462648.1.66824 WP_000462648.1.66860 WP_000462648.1.66953 WP_000462648.1.66955 WP_000462648.1.66981 WP_000462648.1.67024 WP_000462648.1.67042 WP_000462648.1.67101 WP_000462648.1.67143 WP_000462648.1.67201 WP_000462648.1.67211 WP_000462648.1.67237 WP_000462648.1.67336 WP_000462648.1.67339 WP_000462648.1.67387 WP_000462648.1.67394 WP_000462648.1.67397 WP_000462648.1.67403 WP_000462648.1.67430 WP_000462648.1.67442 WP_000462648.1.67539 WP_000462648.1.67556 WP_000462648.1.67576 WP_000462648.1.67604 WP_000462648.1.67619 WP_000462648.1.67625 WP_000462648.1.67627 WP_000462648.1.67641 WP_000462648.1.67657 WP_000462648.1.67673 WP_000462648.1.67700 WP_000462648.1.67718 WP_000462648.1.67729 WP_000462648.1.67774 WP_000462648.1.67820 WP_000462648.1.67910 WP_000462648.1.67954 WP_000462648.1.68 WP_000462648.1.68043 WP_000462648.1.68105 WP_000462648.1.68113 WP_000462648.1.68131 WP_000462648.1.68182 WP_000462648.1.6819 WP_000462648.1.68285 WP_000462648.1.68359 WP_000462648.1.68420 WP_000462648.1.68478 WP_000462648.1.68514 WP_000462648.1.68564 WP_000462648.1.68688 WP_000462648.1.68742 WP_000462648.1.68770 WP_000462648.1.68809 WP_000462648.1.68914 WP_000462648.1.69053 WP_000462648.1.69170 WP_000462648.1.69210 WP_000462648.1.69270 WP_000462648.1.69282 WP_000462648.1.69376 WP_000462648.1.69396 WP_000462648.1.69466 WP_000462648.1.69611 WP_000462648.1.69642 WP_000462648.1.69656 WP_000462648.1.69657 WP_000462648.1.69690 WP_000462648.1.69923 WP_000462648.1.69948 WP_000462648.1.69953 WP_000462648.1.70010 WP_000462648.1.70049 WP_000462648.1.70058 WP_000462648.1.70061 WP_000462648.1.70205 WP_000462648.1.70240 WP_000462648.1.70249 WP_000462648.1.70261 WP_000462648.1.70314 WP_000462648.1.7033 WP_000462648.1.70427 WP_000462648.1.70433 WP_000462648.1.70545 WP_000462648.1.70623 WP_000462648.1.70671 WP_000462648.1.70679 WP_000462648.1.70708 WP_000462648.1.70717 WP_000462648.1.70731 WP_000462648.1.70772 WP_000462648.1.70845 WP_000462648.1.70846 WP_000462648.1.70969 WP_000462648.1.70981 WP_000462648.1.70995 WP_000462648.1.71039 WP_000462648.1.71057 WP_000462648.1.71081 WP_000462648.1.71117 WP_000462648.1.71186 WP_000462648.1.71407 WP_000462648.1.71455 WP_000462648.1.71456 WP_000462648.1.71487 WP_000462648.1.71523 WP_000462648.1.71542 WP_000462648.1.71566 WP_000462648.1.71640 WP_000462648.1.71651 WP_000462648.1.71653 WP_000462648.1.71716 WP_000462648.1.71872 WP_000462648.1.71950 WP_000462648.1.71954 WP_000462648.1.71985 WP_000462648.1.72003 WP_000462648.1.72073 WP_000462648.1.72269 WP_000462648.1.72350 WP_000462648.1.72383 WP_000462648.1.72461 WP_000462648.1.72527 WP_000462648.1.7255 WP_000462648.1.72631 WP_000462648.1.72638 WP_000462648.1.72667 WP_000462648.1.72674 WP_000462648.1.72724 WP_000462648.1.72789 WP_000462648.1.72828 WP_000462648.1.72896 WP_000462648.1.72969 WP_000462648.1.72987 WP_000462648.1.73052 WP_000462648.1.7311 WP_000462648.1.73114 WP_000462648.1.73164 WP_000462648.1.73177 WP_000462648.1.73180 WP_000462648.1.73258 WP_000462648.1.73285 WP_000462648.1.7332 WP_000462648.1.7333 WP_000462648.1.73352 WP_000462648.1.73389 WP_000462648.1.73425 WP_000462648.1.73488 WP_000462648.1.73504 WP_000462648.1.7353 WP_000462648.1.73544 WP_000462648.1.73598 WP_000462648.1.7361 WP_000462648.1.73648 WP_000462648.1.73768 WP_000462648.1.73849 WP_000462648.1.7394 WP_000462648.1.73948 WP_000462648.1.73999 WP_000462648.1.74024 WP_000462648.1.74030 WP_000462648.1.74038 WP_000462648.1.74043 WP_000462648.1.74058 WP_000462648.1.74070 WP_000462648.1.74077 WP_000462648.1.74135 WP_000462648.1.74214 WP_000462648.1.74241 WP_000462648.1.74285 WP_000462648.1.7430 WP_000462648.1.74317 WP_000462648.1.74415 WP_000462648.1.74500 WP_000462648.1.74616 WP_000462648.1.74621 WP_000462648.1.74647 WP_000462648.1.74677 WP_000462648.1.74699 WP_000462648.1.74831 WP_000462648.1.74894 WP_000462648.1.74929 WP_000462648.1.74939 WP_000462648.1.74973 WP_000462648.1.7507 WP_000462648.1.75089 WP_000462648.1.75116 WP_000462648.1.75237 WP_000462648.1.75273 WP_000462648.1.75296 WP_000462648.1.75413 WP_000462648.1.75433 WP_000462648.1.75532 WP_000462648.1.75565 WP_000462648.1.75593 WP_000462648.1.75610 WP_000462648.1.75633 WP_000462648.1.75718 WP_000462648.1.75745 WP_000462648.1.75844 WP_000462648.1.75886 WP_000462648.1.75898 WP_000462648.1.76081 WP_000462648.1.76116 WP_000462648.1.76122 WP_000462648.1.76256 WP_000462648.1.76339 WP_000462648.1.76366 WP_000462648.1.76417 WP_000462648.1.7646 WP_000462648.1.76510 WP_000462648.1.76558 WP_000462648.1.76572 WP_000462648.1.76641 WP_000462648.1.76651 WP_000462648.1.76653 WP_000462648.1.76788 WP_000462648.1.76854 WP_000462648.1.76932 WP_000462648.1.76973 WP_000462648.1.76988 WP_000462648.1.77016 WP_000462648.1.77087 WP_000462648.1.77090 WP_000462648.1.77111 WP_000462648.1.77299 WP_000462648.1.77384 WP_000462648.1.77501 WP_000462648.1.77512 WP_000462648.1.77513 WP_000462648.1.77563 WP_000462648.1.77702 WP_000462648.1.77713 WP_000462648.1.7772 WP_000462648.1.77825 WP_000462648.1.77837 WP_000462648.1.77900 WP_000462648.1.77923 WP_000462648.1.77975 WP_000462648.1.78035 WP_000462648.1.78048 WP_000462648.1.78107 WP_000462648.1.78166 WP_000462648.1.78192 WP_000462648.1.78195 WP_000462648.1.78291 WP_000462648.1.78309 WP_000462648.1.78320 WP_000462648.1.78382 WP_000462648.1.78388 WP_000462648.1.78410 WP_000462648.1.7862 WP_000462648.1.78626 WP_000462648.1.78661 WP_000462648.1.78674 WP_000462648.1.78676 WP_000462648.1.78761 WP_000462648.1.789 WP_000462648.1.78993 WP_000462648.1.79012 WP_000462648.1.79069 WP_000462648.1.79074 WP_000462648.1.79098 WP_000462648.1.79155 WP_000462648.1.79164 WP_000462648.1.79280 WP_000462648.1.79397 WP_000462648.1.79456 WP_000462648.1.79532 WP_000462648.1.79547 WP_000462648.1.79654 WP_000462648.1.7970 WP_000462648.1.79722 WP_000462648.1.79772 WP_000462648.1.79880 WP_000462648.1.79916 WP_000462648.1.80065 WP_000462648.1.80103 WP_000462648.1.80273 WP_000462648.1.80282 WP_000462648.1.80293 WP_000462648.1.80354 WP_000462648.1.80368 WP_000462648.1.80386 WP_000462648.1.80400 WP_000462648.1.80462 WP_000462648.1.8049 WP_000462648.1.80492 WP_000462648.1.80569 WP_000462648.1.80664 WP_000462648.1.80696 WP_000462648.1.80984 WP_000462648.1.81131 WP_000462648.1.81187 WP_000462648.1.81262 WP_000462648.1.81268 WP_000462648.1.81269 WP_000462648.1.81271 WP_000462648.1.8131 WP_000462648.1.81333 WP_000462648.1.81342 WP_000462648.1.81364 WP_000462648.1.81494 WP_000462648.1.81557 WP_000462648.1.81676 WP_000462648.1.81681 WP_000462648.1.8170 WP_000462648.1.81763 WP_000462648.1.81855 WP_000462648.1.81921 WP_000462648.1.81931 WP_000462648.1.81936 WP_000462648.1.81949 WP_000462648.1.82070 WP_000462648.1.82076 WP_000462648.1.82131 WP_000462648.1.82156 WP_000462648.1.8218 WP_000462648.1.82180 WP_000462648.1.82201 WP_000462648.1.82214 WP_000462648.1.82225 WP_000462648.1.8240 WP_000462648.1.82408 WP_000462648.1.82416 WP_000462648.1.8242 WP_000462648.1.82456 WP_000462648.1.82465 WP_000462648.1.82473 WP_000462648.1.82553 WP_000462648.1.82646 WP_000462648.1.82670 WP_000462648.1.82731 WP_000462648.1.82812 WP_000462648.1.82850 WP_000462648.1.82872 WP_000462648.1.8294 WP_000462648.1.82959 WP_000462648.1.83007 WP_000462648.1.8304 WP_000462648.1.83180 WP_000462648.1.83229 WP_000462648.1.83235 WP_000462648.1.83290 WP_000462648.1.83333 WP_000462648.1.83657 WP_000462648.1.83677 WP_000462648.1.8375 WP_000462648.1.83923 WP_000462648.1.83994 WP_000462648.1.84 WP_000462648.1.8406 WP_000462648.1.84076 WP_000462648.1.84110 WP_000462648.1.84127 WP_000462648.1.84150 WP_000462648.1.84230 WP_000462648.1.84252 WP_000462648.1.8431 WP_000462648.1.84345 WP_000462648.1.84369 WP_000462648.1.84401 WP_000462648.1.84567 WP_000462648.1.84631 WP_000462648.1.84727 WP_000462648.1.84744 WP_000462648.1.84773 WP_000462648.1.84945 WP_000462648.1.84967 WP_000462648.1.85004 WP_000462648.1.85153 WP_000462648.1.85273 WP_000462648.1.85338 WP_000462648.1.85339 WP_000462648.1.85511 WP_000462648.1.85512 WP_000462648.1.8557 WP_000462648.1.85606 WP_000462648.1.85635 WP_000462648.1.85646 WP_000462648.1.85665 WP_000462648.1.85669 WP_000462648.1.85688 WP_000462648.1.85703 WP_000462648.1.85728 WP_000462648.1.85746 WP_000462648.1.85811 WP_000462648.1.859 WP_000462648.1.85917 WP_000462648.1.8594 WP_000462648.1.85977 WP_000462648.1.860 WP_000462648.1.8605 WP_000462648.1.86084 WP_000462648.1.8610 WP_000462648.1.8614 WP_000462648.1.86156 WP_000462648.1.86323 WP_000462648.1.86342 WP_000462648.1.8640 WP_000462648.1.8642 WP_000462648.1.86426 WP_000462648.1.86489 WP_000462648.1.86530 WP_000462648.1.86663 WP_000462648.1.86770 WP_000462648.1.86794 WP_000462648.1.86800 WP_000462648.1.86811 WP_000462648.1.86815 WP_000462648.1.86945 WP_000462648.1.86989 WP_000462648.1.87023 WP_000462648.1.87034 WP_000462648.1.87041 WP_000462648.1.87136 WP_000462648.1.87155 WP_000462648.1.87219 WP_000462648.1.87293 WP_000462648.1.87420 WP_000462648.1.87528 WP_000462648.1.87560 WP_000462648.1.8760 WP_000462648.1.87600 WP_000462648.1.87609 WP_000462648.1.87612 WP_000462648.1.87615 WP_000462648.1.87618 WP_000462648.1.87626 WP_000462648.1.87653 WP_000462648.1.87659 WP_000462648.1.87698 WP_000462648.1.87706 WP_000462648.1.87739 WP_000462648.1.87741 WP_000462648.1.87742 WP_000462648.1.87852 WP_000462648.1.87949 WP_000462648.1.88025 WP_000462648.1.88026 WP_000462648.1.8805 WP_000462648.1.8806 WP_000462648.1.881 WP_000462648.1.88145 WP_000462648.1.88199 WP_000462648.1.88299 WP_000462648.1.88313 WP_000462648.1.88359 WP_000462648.1.88407 WP_000462648.1.88414 WP_000462648.1.88444 WP_000462648.1.88446 WP_000462648.1.88458 WP_000462648.1.88501 WP_000462648.1.88538 WP_000462648.1.88547 WP_000462648.1.886 WP_000462648.1.88647 WP_000462648.1.88648 WP_000462648.1.88692 WP_000462648.1.88707 WP_000462648.1.88727 WP_000462648.1.88772 WP_000462648.1.88850 WP_000462648.1.8889 WP_000462648.1.88892 WP_000462648.1.88894 WP_000462648.1.89182 WP_000462648.1.89298 WP_000462648.1.89308 WP_000462648.1.89314 WP_000462648.1.89328 WP_000462648.1.89332 WP_000462648.1.89343 WP_000462648.1.89395 WP_000462648.1.8940 WP_000462648.1.89449 WP_000462648.1.8947 WP_000462648.1.89503 WP_000462648.1.89591 WP_000462648.1.89612 WP_000462648.1.89668 WP_000462648.1.89706 WP_000462648.1.89713 WP_000462648.1.89733 WP_000462648.1.89796 WP_000462648.1.89804 WP_000462648.1.89845 WP_000462648.1.89888 WP_000462648.1.89911 WP_000462648.1.89940 WP_000462648.1.8995 WP_000462648.1.89952 WP_000462648.1.90007 WP_000462648.1.90108 WP_000462648.1.9011 WP_000462648.1.90196 WP_000462648.1.90240 WP_000462648.1.90274 WP_000462648.1.90280 WP_000462648.1.90330 WP_000462648.1.90338 WP_000462648.1.90365 WP_000462648.1.90428 WP_000462648.1.90489 WP_000462648.1.90513 WP_000462648.1.90582 WP_000462648.1.90713 WP_000462648.1.90794 WP_000462648.1.90796 WP_000462648.1.90811 WP_000462648.1.9091 WP_000462648.1.91067 WP_000462648.1.91164 WP_000462648.1.91205 WP_000462648.1.91239 WP_000462648.1.91291 WP_000462648.1.91313 WP_000462648.1.9135 WP_000462648.1.91506 WP_000462648.1.91557 WP_000462648.1.91597 WP_000462648.1.91715 WP_000462648.1.9187 WP_000462648.1.91870 WP_000462648.1.92018 WP_000462648.1.92087 WP_000462648.1.92098 WP_000462648.1.92156 WP_000462648.1.92172 WP_000462648.1.92240 WP_000462648.1.92243 WP_000462648.1.92327 WP_000462648.1.92470 WP_000462648.1.92477 WP_000462648.1.92545 WP_000462648.1.92570 WP_000462648.1.92588 WP_000462648.1.926 WP_000462648.1.92633 WP_000462648.1.92649 WP_000462648.1.92676 WP_000462648.1.92705 WP_000462648.1.9271 WP_000462648.1.92734 WP_000462648.1.92810 WP_000462648.1.92823 WP_000462648.1.92987 WP_000462648.1.93007 WP_000462648.1.93022 WP_000462648.1.93103 WP_000462648.1.93105 WP_000462648.1.93111 WP_000462648.1.93121 WP_000462648.1.93168 WP_000462648.1.93184 WP_000462648.1.93221 WP_000462648.1.93223 WP_000462648.1.93239 WP_000462648.1.93302 WP_000462648.1.9336 WP_000462648.1.93387 WP_000462648.1.93469 WP_000462648.1.93511 WP_000462648.1.93512 WP_000462648.1.93635 WP_000462648.1.93657 WP_000462648.1.9374 WP_000462648.1.9375 WP_000462648.1.93754 WP_000462648.1.93780 WP_000462648.1.93828 WP_000462648.1.93842 WP_000462648.1.93843 WP_000462648.1.93875 WP_000462648.1.93909 WP_000462648.1.93919 WP_000462648.1.93938 WP_000462648.1.93984 WP_000462648.1.9399 WP_000462648.1.94017 WP_000462648.1.94079 WP_000462648.1.94097 WP_000462648.1.94107 WP_000462648.1.94142 WP_000462648.1.94215 WP_000462648.1.94303 WP_000462648.1.94365 WP_000462648.1.94390 WP_000462648.1.94415 WP_000462648.1.94492 WP_000462648.1.94510 WP_000462648.1.94527 WP_000462648.1.94573 WP_000462648.1.94579 WP_000462648.1.94586 WP_000462648.1.94593 WP_000462648.1.94650 WP_000462648.1.94659 WP_000462648.1.94662 WP_000462648.1.94700 WP_000462648.1.94745 WP_000462648.1.94782 WP_000462648.1.94815 WP_000462648.1.94820 WP_000462648.1.94850 WP_000462648.1.94851 WP_000462648.1.94864 WP_000462648.1.94952 WP_000462648.1.95006 WP_000462648.1.95055 WP_000462648.1.95076 WP_000462648.1.95099 WP_000462648.1.95165 WP_000462648.1.95239 WP_000462648.1.95246 WP_000462648.1.9525 WP_000462648.1.95255 WP_000462648.1.95265 WP_000462648.1.95298 WP_000462648.1.95338 WP_000462648.1.95412 WP_000462648.1.95530 WP_000462648.1.95547 WP_000462648.1.95590 WP_000462648.1.95625 WP_000462648.1.95675 WP_000462648.1.95716 WP_000462648.1.95776 WP_000462648.1.95884 WP_000462648.1.95890 WP_000462648.1.95906 WP_000462648.1.96025 WP_000462648.1.96044 WP_000462648.1.96054 WP_000462648.1.96094 WP_000462648.1.96127 WP_000462648.1.96144 WP_000462648.1.96188 WP_000462648.1.96211 WP_000462648.1.96212 WP_000462648.1.96319 WP_000462648.1.9633 WP_000462648.1.96359 WP_000462648.1.96539 WP_000462648.1.96552 WP_000462648.1.96610 WP_000462648.1.96625 WP_000462648.1.96635 WP_000462648.1.9664 WP_000462648.1.96675 WP_000462648.1.9670 WP_000462648.1.96750 WP_000462648.1.96792 WP_000462648.1.96801 WP_000462648.1.96803 WP_000462648.1.96925 WP_000462648.1.96938 WP_000462648.1.96946 WP_000462648.1.96957 WP_000462648.1.96978 WP_000462648.1.97026 WP_000462648.1.97028 WP_000462648.1.97079 WP_000462648.1.97154 WP_000462648.1.97184 WP_000462648.1.97287 WP_000462648.1.97291 WP_000462648.1.97422 WP_000462648.1.97441 WP_000462648.1.97497 WP_000462648.1.97505 WP_000462648.1.97599 WP_000462648.1.97606 WP_000462648.1.97615 WP_000462648.1.97646 WP_000462648.1.97690 WP_000462648.1.97819 WP_000462648.1.97840 WP_000462648.1.97938 WP_000462648.1.97986 WP_000462648.1.98036 WP_000462648.1.98080 WP_000462648.1.98086 WP_000462648.1.98158 WP_000462648.1.98263 WP_000462648.1.98418 WP_000462648.1.98448 WP_000462648.1.98457 WP_000462648.1.9850 WP_000462648.1.98502 WP_000462648.1.98607 WP_000462648.1.98731 WP_000462648.1.98762 WP_000462648.1.98763 WP_000462648.1.9877 WP_000462648.1.98801 WP_000462648.1.98818 WP_000462648.1.99163 WP_000462648.1.99335 WP_000462648.1.99350 WP_000462648.1.99360 WP_000462648.1.99363 WP_000462648.1.99369 WP_000462648.1.99388 WP_000462648.1.99397 WP_000462648.1.99463 WP_000462648.1.99483 WP_000462648.1.99546 WP_000462648.1.99579 WP_000462648.1.99595 WP_000462648.1.99671 WP_000462648.1.99676 WP_000462648.1.99764 WP_000462648.1.99829 WP_000462648.1.99837 WP_000462648.1.99841 WP_000462648.1.9992 WP_000462648.1.99996 209261.t1936 220341.STY1000 gi|378960102|ref|YP_005217588.1| gi|29142360|ref|NP_805702.1| AE014613|CDS_1980964-1982154 AL513382|CDS_1000113-998923 gi|16759867|ref|NP_455484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]