SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16760318|ref|NP_455935.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16760318|ref|NP_455935.1|
Domain Number 1 Region: 5-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.17e-91
Family Cystathionine synthase-like 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16760318|ref|NP_455935.1|
Sequence length 393
Comment aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MCNNTGSVKWDFIERHFGDGAGKLLPMWVSDFDFACPPEVQAALHQRIEHGVFGYSERDE
AYFNALLHWFSSRHQLTLKQEWVCSVEGVVPGLALLVQMLTHPGDGVVVQGPYYGSFAKI
ITLNGRKLLENPLSESPDEGYQMDFCQLERLFRHERPPLMILCNPHNPTGRCWSANELEQ
LLLLCEAYDVTLISDEIWADLLLPCETFTSVLHLGERWHKRVISATAASKTFGLSSLRIS
NFLIPDPTLRQRFLSRLDAHGLDVFNALSVQAATTAWNESRQWLDSLLDYLAENRRWFVE
QATEHLPWARIVPAQGTYLLWMDCKKLGLDDEQLKWVMADVAGIAPSMGSGFGPAGSGFI
RLNLGCPRTYLEMAIDGLKRISVKTIKGIPTGG
Download sequence
Identical sequences Q8Z721
gi|488653985|ref|YP_007925788.1| NP_455935.1.84458 WP_000336171.1.100321 WP_000336171.1.100354 WP_000336171.1.100421 WP_000336171.1.100450 WP_000336171.1.100592 WP_000336171.1.100610 WP_000336171.1.100732 WP_000336171.1.100799 WP_000336171.1.100941 WP_000336171.1.100953 WP_000336171.1.10108 WP_000336171.1.101226 WP_000336171.1.101271 WP_000336171.1.101312 WP_000336171.1.101616 WP_000336171.1.101890 WP_000336171.1.102087 WP_000336171.1.10338 WP_000336171.1.104 WP_000336171.1.10459 WP_000336171.1.10511 WP_000336171.1.10532 WP_000336171.1.10547 WP_000336171.1.10654 WP_000336171.1.10857 WP_000336171.1.10873 WP_000336171.1.10926 WP_000336171.1.11055 WP_000336171.1.11253 WP_000336171.1.11314 WP_000336171.1.1142 WP_000336171.1.11557 WP_000336171.1.11567 WP_000336171.1.11638 WP_000336171.1.11883 WP_000336171.1.11914 WP_000336171.1.12040 WP_000336171.1.12061 WP_000336171.1.1207 WP_000336171.1.12172 WP_000336171.1.12364 WP_000336171.1.12441 WP_000336171.1.12581 WP_000336171.1.12683 WP_000336171.1.12727 WP_000336171.1.12741 WP_000336171.1.12834 WP_000336171.1.13108 WP_000336171.1.1321 WP_000336171.1.133 WP_000336171.1.13338 WP_000336171.1.13352 WP_000336171.1.13440 WP_000336171.1.13443 WP_000336171.1.13476 WP_000336171.1.13686 WP_000336171.1.1372 WP_000336171.1.1397 WP_000336171.1.140 WP_000336171.1.1401 WP_000336171.1.1408 WP_000336171.1.14089 WP_000336171.1.14099 WP_000336171.1.14120 WP_000336171.1.14123 WP_000336171.1.14280 WP_000336171.1.14399 WP_000336171.1.14444 WP_000336171.1.14500 WP_000336171.1.14550 WP_000336171.1.14575 WP_000336171.1.14719 WP_000336171.1.1473 WP_000336171.1.14765 WP_000336171.1.14877 WP_000336171.1.14894 WP_000336171.1.14930 WP_000336171.1.14947 WP_000336171.1.15184 WP_000336171.1.15244 WP_000336171.1.15362 WP_000336171.1.15415 WP_000336171.1.15433 WP_000336171.1.15439 WP_000336171.1.15581 WP_000336171.1.15710 WP_000336171.1.15717 WP_000336171.1.15912 WP_000336171.1.15970 WP_000336171.1.16051 WP_000336171.1.16150 WP_000336171.1.1626 WP_000336171.1.16344 WP_000336171.1.16452 WP_000336171.1.16461 WP_000336171.1.16462 WP_000336171.1.16522 WP_000336171.1.16588 WP_000336171.1.16673 WP_000336171.1.16767 WP_000336171.1.16893 WP_000336171.1.16905 WP_000336171.1.17202 WP_000336171.1.1722 WP_000336171.1.17302 WP_000336171.1.17308 WP_000336171.1.17405 WP_000336171.1.17513 WP_000336171.1.17622 WP_000336171.1.17956 WP_000336171.1.18021 WP_000336171.1.18099 WP_000336171.1.18124 WP_000336171.1.18144 WP_000336171.1.18173 WP_000336171.1.18270 WP_000336171.1.18280 WP_000336171.1.18358 WP_000336171.1.18513 WP_000336171.1.18610 WP_000336171.1.18766 WP_000336171.1.1880 WP_000336171.1.18860 WP_000336171.1.19001 WP_000336171.1.19044 WP_000336171.1.19084 WP_000336171.1.19187 WP_000336171.1.19228 WP_000336171.1.19288 WP_000336171.1.19300 WP_000336171.1.20296 WP_000336171.1.20419 WP_000336171.1.2053 WP_000336171.1.20718 WP_000336171.1.20828 WP_000336171.1.2087 WP_000336171.1.20953 WP_000336171.1.21010 WP_000336171.1.21144 WP_000336171.1.21185 WP_000336171.1.21366 WP_000336171.1.2166 WP_000336171.1.2227 WP_000336171.1.22373 WP_000336171.1.22652 WP_000336171.1.22683 WP_000336171.1.22967 WP_000336171.1.23058 WP_000336171.1.2331 WP_000336171.1.23340 WP_000336171.1.2336 WP_000336171.1.23365 WP_000336171.1.23412 WP_000336171.1.23515 WP_000336171.1.23571 WP_000336171.1.23679 WP_000336171.1.23728 WP_000336171.1.2375 WP_000336171.1.23787 WP_000336171.1.23801 WP_000336171.1.24061 WP_000336171.1.24291 WP_000336171.1.24322 WP_000336171.1.24420 WP_000336171.1.24619 WP_000336171.1.24832 WP_000336171.1.25017 WP_000336171.1.25140 WP_000336171.1.25196 WP_000336171.1.25219 WP_000336171.1.25374 WP_000336171.1.25475 WP_000336171.1.25490 WP_000336171.1.25508 WP_000336171.1.25603 WP_000336171.1.25666 WP_000336171.1.25911 WP_000336171.1.25963 WP_000336171.1.26001 WP_000336171.1.2615 WP_000336171.1.26286 WP_000336171.1.26288 WP_000336171.1.26394 WP_000336171.1.26491 WP_000336171.1.2654 WP_000336171.1.2679 WP_000336171.1.26908 WP_000336171.1.27077 WP_000336171.1.27115 WP_000336171.1.27228 WP_000336171.1.27285 WP_000336171.1.27309 WP_000336171.1.27329 WP_000336171.1.27361 WP_000336171.1.27565 WP_000336171.1.27775 WP_000336171.1.27785 WP_000336171.1.27900 WP_000336171.1.2822 WP_000336171.1.28384 WP_000336171.1.28386 WP_000336171.1.284 WP_000336171.1.28479 WP_000336171.1.28627 WP_000336171.1.29023 WP_000336171.1.29042 WP_000336171.1.29153 WP_000336171.1.29203 WP_000336171.1.29237 WP_000336171.1.29248 WP_000336171.1.29439 WP_000336171.1.29563 WP_000336171.1.29727 WP_000336171.1.29743 WP_000336171.1.29851 WP_000336171.1.29886 WP_000336171.1.29964 WP_000336171.1.30009 WP_000336171.1.30013 WP_000336171.1.30185 WP_000336171.1.30357 WP_000336171.1.30362 WP_000336171.1.30448 WP_000336171.1.30489 WP_000336171.1.30542 WP_000336171.1.30556 WP_000336171.1.30572 WP_000336171.1.30618 WP_000336171.1.30806 WP_000336171.1.30967 WP_000336171.1.31205 WP_000336171.1.31352 WP_000336171.1.31389 WP_000336171.1.31533 WP_000336171.1.31951 WP_000336171.1.32041 WP_000336171.1.32263 WP_000336171.1.32293 WP_000336171.1.32458 WP_000336171.1.32460 WP_000336171.1.32529 WP_000336171.1.32563 WP_000336171.1.32578 WP_000336171.1.32617 WP_000336171.1.32838 WP_000336171.1.32848 WP_000336171.1.32868 WP_000336171.1.32940 WP_000336171.1.32941 WP_000336171.1.3296 WP_000336171.1.33051 WP_000336171.1.33065 WP_000336171.1.33283 WP_000336171.1.33339 WP_000336171.1.33501 WP_000336171.1.33689 WP_000336171.1.3370 WP_000336171.1.33730 WP_000336171.1.33741 WP_000336171.1.3392 WP_000336171.1.33926 WP_000336171.1.33969 WP_000336171.1.34001 WP_000336171.1.34059 WP_000336171.1.34284 WP_000336171.1.34376 WP_000336171.1.34484 WP_000336171.1.34694 WP_000336171.1.34808 WP_000336171.1.34824 WP_000336171.1.34834 WP_000336171.1.34932 WP_000336171.1.34962 WP_000336171.1.35001 WP_000336171.1.35040 WP_000336171.1.35240 WP_000336171.1.35274 WP_000336171.1.35560 WP_000336171.1.3570 WP_000336171.1.35713 WP_000336171.1.35870 WP_000336171.1.35916 WP_000336171.1.35938 WP_000336171.1.36069 WP_000336171.1.36291 WP_000336171.1.36323 WP_000336171.1.36460 WP_000336171.1.3649 WP_000336171.1.36567 WP_000336171.1.36617 WP_000336171.1.36701 WP_000336171.1.36779 WP_000336171.1.36798 WP_000336171.1.36802 WP_000336171.1.36853 WP_000336171.1.36950 WP_000336171.1.37014 WP_000336171.1.37133 WP_000336171.1.37200 WP_000336171.1.37258 WP_000336171.1.37584 WP_000336171.1.37590 WP_000336171.1.37600 WP_000336171.1.37613 WP_000336171.1.37659 WP_000336171.1.37662 WP_000336171.1.37761 WP_000336171.1.37775 WP_000336171.1.37911 WP_000336171.1.37941 WP_000336171.1.37985 WP_000336171.1.38108 WP_000336171.1.38261 WP_000336171.1.38351 WP_000336171.1.38381 WP_000336171.1.38515 WP_000336171.1.38595 WP_000336171.1.38642 WP_000336171.1.38734 WP_000336171.1.39056 WP_000336171.1.3907 WP_000336171.1.39105 WP_000336171.1.39161 WP_000336171.1.39235 WP_000336171.1.3931 WP_000336171.1.39435 WP_000336171.1.39619 WP_000336171.1.39624 WP_000336171.1.39775 WP_000336171.1.39941 WP_000336171.1.39945 WP_000336171.1.40097 WP_000336171.1.40167 WP_000336171.1.40279 WP_000336171.1.40361 WP_000336171.1.4042 WP_000336171.1.40496 WP_000336171.1.40698 WP_000336171.1.40750 WP_000336171.1.4089 WP_000336171.1.40946 WP_000336171.1.41004 WP_000336171.1.41070 WP_000336171.1.41075 WP_000336171.1.41097 WP_000336171.1.41251 WP_000336171.1.41258 WP_000336171.1.41305 WP_000336171.1.41459 WP_000336171.1.41498 WP_000336171.1.41631 WP_000336171.1.41824 WP_000336171.1.41894 WP_000336171.1.41919 WP_000336171.1.42081 WP_000336171.1.42090 WP_000336171.1.42111 WP_000336171.1.42200 WP_000336171.1.42219 WP_000336171.1.42261 WP_000336171.1.42364 WP_000336171.1.42399 WP_000336171.1.42650 WP_000336171.1.42701 WP_000336171.1.42805 WP_000336171.1.42859 WP_000336171.1.4298 WP_000336171.1.43008 WP_000336171.1.43016 WP_000336171.1.43068 WP_000336171.1.43069 WP_000336171.1.43128 WP_000336171.1.43190 WP_000336171.1.43198 WP_000336171.1.4326 WP_000336171.1.43290 WP_000336171.1.43292 WP_000336171.1.43513 WP_000336171.1.43633 WP_000336171.1.43637 WP_000336171.1.43651 WP_000336171.1.43722 WP_000336171.1.43801 WP_000336171.1.43812 WP_000336171.1.43878 WP_000336171.1.43888 WP_000336171.1.43974 WP_000336171.1.44101 WP_000336171.1.44160 WP_000336171.1.44196 WP_000336171.1.44268 WP_000336171.1.44296 WP_000336171.1.44343 WP_000336171.1.44360 WP_000336171.1.44416 WP_000336171.1.44431 WP_000336171.1.44546 WP_000336171.1.44815 WP_000336171.1.44828 WP_000336171.1.44879 WP_000336171.1.44917 WP_000336171.1.45072 WP_000336171.1.45093 WP_000336171.1.45241 WP_000336171.1.45596 WP_000336171.1.46077 WP_000336171.1.46169 WP_000336171.1.46225 WP_000336171.1.46241 WP_000336171.1.46355 WP_000336171.1.46454 WP_000336171.1.46461 WP_000336171.1.46504 WP_000336171.1.46505 WP_000336171.1.46551 WP_000336171.1.46559 WP_000336171.1.46701 WP_000336171.1.46781 WP_000336171.1.46816 WP_000336171.1.46920 WP_000336171.1.46945 WP_000336171.1.47036 WP_000336171.1.47037 WP_000336171.1.47215 WP_000336171.1.47245 WP_000336171.1.47523 WP_000336171.1.47531 WP_000336171.1.47630 WP_000336171.1.4774 WP_000336171.1.4781 WP_000336171.1.47886 WP_000336171.1.48019 WP_000336171.1.48139 WP_000336171.1.48586 WP_000336171.1.4859 WP_000336171.1.48591 WP_000336171.1.48610 WP_000336171.1.48631 WP_000336171.1.48663 WP_000336171.1.48690 WP_000336171.1.48756 WP_000336171.1.48778 WP_000336171.1.48849 WP_000336171.1.48955 WP_000336171.1.48963 WP_000336171.1.48973 WP_000336171.1.49004 WP_000336171.1.49117 WP_000336171.1.49121 WP_000336171.1.4914 WP_000336171.1.49140 WP_000336171.1.49166 WP_000336171.1.49355 WP_000336171.1.49429 WP_000336171.1.49434 WP_000336171.1.495 WP_000336171.1.49703 WP_000336171.1.49769 WP_000336171.1.49959 WP_000336171.1.49997 WP_000336171.1.50043 WP_000336171.1.50247 WP_000336171.1.50308 WP_000336171.1.50309 WP_000336171.1.50387 WP_000336171.1.5051 WP_000336171.1.50626 WP_000336171.1.50726 WP_000336171.1.50771 WP_000336171.1.50885 WP_000336171.1.509 WP_000336171.1.50970 WP_000336171.1.51227 WP_000336171.1.51519 WP_000336171.1.51598 WP_000336171.1.51644 WP_000336171.1.51838 WP_000336171.1.52057 WP_000336171.1.52114 WP_000336171.1.52129 WP_000336171.1.52191 WP_000336171.1.52209 WP_000336171.1.52339 WP_000336171.1.52647 WP_000336171.1.52773 WP_000336171.1.52795 WP_000336171.1.52887 WP_000336171.1.53092 WP_000336171.1.53141 WP_000336171.1.53151 WP_000336171.1.53154 WP_000336171.1.53159 WP_000336171.1.53210 WP_000336171.1.53233 WP_000336171.1.53307 WP_000336171.1.53321 WP_000336171.1.53375 WP_000336171.1.53540 WP_000336171.1.5358 WP_000336171.1.53692 WP_000336171.1.53723 WP_000336171.1.5374 WP_000336171.1.53800 WP_000336171.1.53815 WP_000336171.1.53898 WP_000336171.1.53981 WP_000336171.1.54132 WP_000336171.1.54170 WP_000336171.1.54175 WP_000336171.1.54203 WP_000336171.1.54259 WP_000336171.1.5430 WP_000336171.1.54371 WP_000336171.1.54431 WP_000336171.1.54442 WP_000336171.1.54482 WP_000336171.1.54589 WP_000336171.1.54667 WP_000336171.1.54678 WP_000336171.1.54865 WP_000336171.1.55379 WP_000336171.1.55506 WP_000336171.1.55639 WP_000336171.1.55699 WP_000336171.1.55725 WP_000336171.1.55967 WP_000336171.1.5621 WP_000336171.1.56311 WP_000336171.1.56514 WP_000336171.1.56585 WP_000336171.1.56640 WP_000336171.1.56724 WP_000336171.1.56825 WP_000336171.1.56889 WP_000336171.1.57137 WP_000336171.1.57147 WP_000336171.1.57186 WP_000336171.1.57684 WP_000336171.1.57699 WP_000336171.1.57785 WP_000336171.1.57800 WP_000336171.1.57873 WP_000336171.1.57972 WP_000336171.1.5809 WP_000336171.1.58173 WP_000336171.1.58274 WP_000336171.1.58282 WP_000336171.1.58326 WP_000336171.1.58537 WP_000336171.1.58724 WP_000336171.1.58847 WP_000336171.1.58883 WP_000336171.1.58898 WP_000336171.1.58963 WP_000336171.1.58974 WP_000336171.1.59056 WP_000336171.1.59064 WP_000336171.1.59282 WP_000336171.1.59299 WP_000336171.1.5949 WP_000336171.1.59751 WP_000336171.1.59829 WP_000336171.1.59969 WP_000336171.1.60114 WP_000336171.1.60154 WP_000336171.1.60192 WP_000336171.1.60212 WP_000336171.1.60253 WP_000336171.1.60324 WP_000336171.1.60380 WP_000336171.1.60481 WP_000336171.1.6058 WP_000336171.1.60584 WP_000336171.1.60676 WP_000336171.1.60783 WP_000336171.1.60889 WP_000336171.1.60950 WP_000336171.1.61123 WP_000336171.1.61168 WP_000336171.1.61357 WP_000336171.1.61511 WP_000336171.1.61539 WP_000336171.1.61553 WP_000336171.1.61652 WP_000336171.1.61697 WP_000336171.1.61920 WP_000336171.1.62223 WP_000336171.1.62302 WP_000336171.1.62411 WP_000336171.1.62475 WP_000336171.1.62640 WP_000336171.1.62686 WP_000336171.1.62751 WP_000336171.1.62913 WP_000336171.1.62932 WP_000336171.1.62960 WP_000336171.1.63016 WP_000336171.1.63069 WP_000336171.1.63087 WP_000336171.1.63169 WP_000336171.1.63583 WP_000336171.1.63592 WP_000336171.1.63736 WP_000336171.1.63816 WP_000336171.1.6389 WP_000336171.1.63955 WP_000336171.1.63963 WP_000336171.1.64032 WP_000336171.1.64293 WP_000336171.1.64332 WP_000336171.1.644 WP_000336171.1.64471 WP_000336171.1.64501 WP_000336171.1.64632 WP_000336171.1.64654 WP_000336171.1.64663 WP_000336171.1.64744 WP_000336171.1.64763 WP_000336171.1.64817 WP_000336171.1.64847 WP_000336171.1.64891 WP_000336171.1.64974 WP_000336171.1.65075 WP_000336171.1.6514 WP_000336171.1.65172 WP_000336171.1.65191 WP_000336171.1.65200 WP_000336171.1.65211 WP_000336171.1.65218 WP_000336171.1.65249 WP_000336171.1.65697 WP_000336171.1.65737 WP_000336171.1.65755 WP_000336171.1.65812 WP_000336171.1.65863 WP_000336171.1.66031 WP_000336171.1.66064 WP_000336171.1.66145 WP_000336171.1.66183 WP_000336171.1.6620 WP_000336171.1.66216 WP_000336171.1.66234 WP_000336171.1.66273 WP_000336171.1.66324 WP_000336171.1.66361 WP_000336171.1.66506 WP_000336171.1.66665 WP_000336171.1.66681 WP_000336171.1.66759 WP_000336171.1.66801 WP_000336171.1.66981 WP_000336171.1.67101 WP_000336171.1.67143 WP_000336171.1.67211 WP_000336171.1.67237 WP_000336171.1.67339 WP_000336171.1.67387 WP_000336171.1.67430 WP_000336171.1.67442 WP_000336171.1.67539 WP_000336171.1.67576 WP_000336171.1.67604 WP_000336171.1.67619 WP_000336171.1.67641 WP_000336171.1.67673 WP_000336171.1.67700 WP_000336171.1.67820 WP_000336171.1.67910 WP_000336171.1.67954 WP_000336171.1.68 WP_000336171.1.68043 WP_000336171.1.68113 WP_000336171.1.68131 WP_000336171.1.68420 WP_000336171.1.68688 WP_000336171.1.68770 WP_000336171.1.69053 WP_000336171.1.69270 WP_000336171.1.69282 WP_000336171.1.69611 WP_000336171.1.69656 WP_000336171.1.69657 WP_000336171.1.69690 WP_000336171.1.69923 WP_000336171.1.70010 WP_000336171.1.70049 WP_000336171.1.70061 WP_000336171.1.70205 WP_000336171.1.70249 WP_000336171.1.70314 WP_000336171.1.7033 WP_000336171.1.70427 WP_000336171.1.70671 WP_000336171.1.70679 WP_000336171.1.70708 WP_000336171.1.70717 WP_000336171.1.70731 WP_000336171.1.70846 WP_000336171.1.70995 WP_000336171.1.71057 WP_000336171.1.71117 WP_000336171.1.71455 WP_000336171.1.71456 WP_000336171.1.71523 WP_000336171.1.71640 WP_000336171.1.71651 WP_000336171.1.71985 WP_000336171.1.72003 WP_000336171.1.72269 WP_000336171.1.72350 WP_000336171.1.72383 WP_000336171.1.7255 WP_000336171.1.72638 WP_000336171.1.72667 WP_000336171.1.72896 WP_000336171.1.72969 WP_000336171.1.7311 WP_000336171.1.73114 WP_000336171.1.73177 WP_000336171.1.73180 WP_000336171.1.73389 WP_000336171.1.73425 WP_000336171.1.73488 WP_000336171.1.73504 WP_000336171.1.7361 WP_000336171.1.73768 WP_000336171.1.73849 WP_000336171.1.73999 WP_000336171.1.74024 WP_000336171.1.74030 WP_000336171.1.74038 WP_000336171.1.74077 WP_000336171.1.74214 WP_000336171.1.74241 WP_000336171.1.7430 WP_000336171.1.74317 WP_000336171.1.74616 WP_000336171.1.74621 WP_000336171.1.74647 WP_000336171.1.74677 WP_000336171.1.74699 WP_000336171.1.74831 WP_000336171.1.74894 WP_000336171.1.74929 WP_000336171.1.74939 WP_000336171.1.75089 WP_000336171.1.75116 WP_000336171.1.75273 WP_000336171.1.75296 WP_000336171.1.75565 WP_000336171.1.75610 WP_000336171.1.75886 WP_000336171.1.76122 WP_000336171.1.76256 WP_000336171.1.76339 WP_000336171.1.76366 WP_000336171.1.76417 WP_000336171.1.76510 WP_000336171.1.76788 WP_000336171.1.76854 WP_000336171.1.76916 WP_000336171.1.76988 WP_000336171.1.77384 WP_000336171.1.77501 WP_000336171.1.77512 WP_000336171.1.77513 WP_000336171.1.77563 WP_000336171.1.77702 WP_000336171.1.77713 WP_000336171.1.77825 WP_000336171.1.77837 WP_000336171.1.78291 WP_000336171.1.7862 WP_000336171.1.78626 WP_000336171.1.78661 WP_000336171.1.78761 WP_000336171.1.79155 WP_000336171.1.79164 WP_000336171.1.79204 WP_000336171.1.79397 WP_000336171.1.79547 WP_000336171.1.7970 WP_000336171.1.79772 WP_000336171.1.79916 WP_000336171.1.80103 WP_000336171.1.80273 WP_000336171.1.80282 WP_000336171.1.80354 WP_000336171.1.80368 WP_000336171.1.80400 WP_000336171.1.80462 WP_000336171.1.8049 WP_000336171.1.80664 WP_000336171.1.80696 WP_000336171.1.80984 WP_000336171.1.81187 WP_000336171.1.81268 WP_000336171.1.81271 WP_000336171.1.81333 WP_000336171.1.81494 WP_000336171.1.81557 WP_000336171.1.81681 WP_000336171.1.81763 WP_000336171.1.81936 WP_000336171.1.82131 WP_000336171.1.8218 WP_000336171.1.82180 WP_000336171.1.82214 WP_000336171.1.82225 WP_000336171.1.82408 WP_000336171.1.82456 WP_000336171.1.82465 WP_000336171.1.82473 WP_000336171.1.82646 WP_000336171.1.82812 WP_000336171.1.82850 WP_000336171.1.82872 WP_000336171.1.83007 WP_000336171.1.83180 WP_000336171.1.83229 WP_000336171.1.83235 WP_000336171.1.83333 WP_000336171.1.83677 WP_000336171.1.8375 WP_000336171.1.84 WP_000336171.1.8406 WP_000336171.1.84110 WP_000336171.1.84150 WP_000336171.1.84230 WP_000336171.1.84345 WP_000336171.1.84369 WP_000336171.1.84727 WP_000336171.1.85004 WP_000336171.1.8502 WP_000336171.1.85039 WP_000336171.1.85153 WP_000336171.1.85338 WP_000336171.1.85635 WP_000336171.1.85665 WP_000336171.1.85703 WP_000336171.1.85811 WP_000336171.1.859 WP_000336171.1.85917 WP_000336171.1.85977 WP_000336171.1.860 WP_000336171.1.86156 WP_000336171.1.86323 WP_000336171.1.8640 WP_000336171.1.86426 WP_000336171.1.86530 WP_000336171.1.86663 WP_000336171.1.86794 WP_000336171.1.86811 WP_000336171.1.86815 WP_000336171.1.86945 WP_000336171.1.86989 WP_000336171.1.87034 WP_000336171.1.87041 WP_000336171.1.87155 WP_000336171.1.87258 WP_000336171.1.87293 WP_000336171.1.87528 WP_000336171.1.87560 WP_000336171.1.8760 WP_000336171.1.87612 WP_000336171.1.87659 WP_000336171.1.87741 WP_000336171.1.88026 WP_000336171.1.88145 WP_000336171.1.88299 WP_000336171.1.88313 WP_000336171.1.88359 WP_000336171.1.88414 WP_000336171.1.88444 WP_000336171.1.88446 WP_000336171.1.88501 WP_000336171.1.88538 WP_000336171.1.88647 WP_000336171.1.88707 WP_000336171.1.88727 WP_000336171.1.88772 WP_000336171.1.8889 WP_000336171.1.88892 WP_000336171.1.89182 WP_000336171.1.89298 WP_000336171.1.89332 WP_000336171.1.8940 WP_000336171.1.89503 WP_000336171.1.89591 WP_000336171.1.89668 WP_000336171.1.89706 WP_000336171.1.89713 WP_000336171.1.89845 WP_000336171.1.89911 WP_000336171.1.89952 WP_000336171.1.9011 WP_000336171.1.90240 WP_000336171.1.90274 WP_000336171.1.90330 WP_000336171.1.90365 WP_000336171.1.90428 WP_000336171.1.90794 WP_000336171.1.90811 WP_000336171.1.91164 WP_000336171.1.91313 WP_000336171.1.9135 WP_000336171.1.91506 WP_000336171.1.91715 WP_000336171.1.9187 WP_000336171.1.92156 WP_000336171.1.92243 WP_000336171.1.92477 WP_000336171.1.92676 WP_000336171.1.92705 WP_000336171.1.92810 WP_000336171.1.92987 WP_000336171.1.93103 WP_000336171.1.93111 WP_000336171.1.93184 WP_000336171.1.93239 WP_000336171.1.93387 WP_000336171.1.93469 WP_000336171.1.93511 WP_000336171.1.93512 WP_000336171.1.93635 WP_000336171.1.9374 WP_000336171.1.93780 WP_000336171.1.93828 WP_000336171.1.93875 WP_000336171.1.93919 WP_000336171.1.93938 WP_000336171.1.93984 WP_000336171.1.9399 WP_000336171.1.94017 WP_000336171.1.94097 WP_000336171.1.94107 WP_000336171.1.94142 WP_000336171.1.94415 WP_000336171.1.94510 WP_000336171.1.94527 WP_000336171.1.94579 WP_000336171.1.94586 WP_000336171.1.94659 WP_000336171.1.94745 WP_000336171.1.94782 WP_000336171.1.94815 WP_000336171.1.94820 WP_000336171.1.94851 WP_000336171.1.94952 WP_000336171.1.95006 WP_000336171.1.95076 WP_000336171.1.9525 WP_000336171.1.95338 WP_000336171.1.95412 WP_000336171.1.95530 WP_000336171.1.95590 WP_000336171.1.95625 WP_000336171.1.95675 WP_000336171.1.95716 WP_000336171.1.95776 WP_000336171.1.96025 WP_000336171.1.96044 WP_000336171.1.96094 WP_000336171.1.96144 WP_000336171.1.96319 WP_000336171.1.9633 WP_000336171.1.96610 WP_000336171.1.96635 WP_000336171.1.96675 WP_000336171.1.9670 WP_000336171.1.96750 WP_000336171.1.96792 WP_000336171.1.96803 WP_000336171.1.96925 WP_000336171.1.96946 WP_000336171.1.97026 WP_000336171.1.97028 WP_000336171.1.97079 WP_000336171.1.97154 WP_000336171.1.97184 WP_000336171.1.97291 WP_000336171.1.97422 WP_000336171.1.97441 WP_000336171.1.97497 WP_000336171.1.97505 WP_000336171.1.97615 WP_000336171.1.97840 WP_000336171.1.97938 WP_000336171.1.97986 WP_000336171.1.98263 WP_000336171.1.98448 WP_000336171.1.98502 WP_000336171.1.98731 WP_000336171.1.98801 WP_000336171.1.99360 WP_000336171.1.99369 WP_000336171.1.99388 WP_000336171.1.99483 WP_000336171.1.99546 WP_000336171.1.99595 WP_000336171.1.99671 WP_000336171.1.99676 WP_000336171.1.99829 WP_000336171.1.99841 WP_000336171.1.9992 gi|16760318|ref|NP_455935.1| gi|29141917|ref|NP_805259.1| AE014613|CDS_1515303-1516484 AL513382|CDS_1466622-1465441 209261.t1470 220341.STY1507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]