SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16760534|ref|NP_456151.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16760534|ref|NP_456151.1|
Domain Number 1 Region: 4-402
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.18e-129
Family Cystathionine synthase-like 0.00000000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16760534|ref|NP_456151.1|
Sequence length 406
Comment amintransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MTFPVEKVRADFPILQREVNGLPLAYLDSAASAQKPNQVIDAESAFYRHGYAAVHRGIHT
LSAQATESMENVRKQASRFINARSAEELVFVRGTTEGINLVANSWGTENIRAGDNIIISE
MEHHANIVPWQMLCERKGAELRVIPLHPDGTLRLETLAALFDDRTRLLAITHVSNVLGTE
NPLPDMIALARQHGAKVLVDGAQAVMHHAVDVQALDCDFYVFSGHKLYGPTGIGILYVKE
ALLQEMPPWEGGGSMISTVSLTQGTTWAKAPWRFEAGTPNTGGIIGLGAAIDYVTSLGLD
KIGDYEQMLMRYALEQLAQVPDITLYGPAQRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAWYGVPAMCRASLAMYNTHEEVDRLVAGLTRIHRLLG
Download sequence
Identical sequences A0A0F6B0W7 A0A0F7J8P8 A0A0H3NAW2 A0A0K6NKX7 A0A0L9F5R0 A0A0M0Q7C9 A0A0R9NM58 A0A0U0WJR8 A0A0U1JN79 A0A1C2ZVE6 A0A1R2Y2T9 A0A1S0ZLK3 A0A1X2RUN4 A0A1X2V4A4 A0A1Z3Q3L5 A0A221Z0P0 A0A265B4P9 A0A267SCZ2 A0A271D082 A0A2D1Y6B1 A0A2D3TWF2 A0A2H9YHG0 A0A2I6M8U3 A0A2I6MLZ1 A0A2I6N022 A0A2I6NE56 A0A2I6NRV8 A0A2K3A4J3 B4T4R6 B4TGK9 B5QVS9 E8XH66 G4C6V7 Q7CQN5 Q8XF77 S4JF88 S5HKR2 V7IJI0 V7UCN9
gi|194442460|ref|YP_002040628.1| gi|386591223|ref|YP_006087623.1| gi|378988713|ref|YP_005251877.1| gi|525826817|ref|YP_008249289.1| gi|525817259|ref|YP_008247277.1| gi|482903182|ref|YP_007901742.1| gi|378449882|ref|YP_005237241.1| gi|16760534|ref|NP_456151.1| 209261.t1241 220341.STY1750 423368.SNSL254_A1486 454169.SeHA_C1505 550537.SEN1672 99287.STM1373 gi|525838397|ref|YP_008255429.1| gi|550900741|ref|YP_008669833.1| gi|383496084|ref|YP_005396773.1| gi|378959407|ref|YP_005216893.1| gi|525857499|ref|YP_008260561.1| gi|16764723|ref|NP_460338.1| gi|207857121|ref|YP_002243772.1| NP_456151.1.84458 NP_460338.1.58477 WP_000143859.1.100002 WP_000143859.1.100007 WP_000143859.1.100008 WP_000143859.1.100010 WP_000143859.1.100031 WP_000143859.1.100036 WP_000143859.1.100077 WP_000143859.1.100079 WP_000143859.1.100115 WP_000143859.1.100129 WP_000143859.1.100137 WP_000143859.1.100149 WP_000143859.1.100191 WP_000143859.1.100196 WP_000143859.1.1002 WP_000143859.1.100234 WP_000143859.1.100258 WP_000143859.1.100266 WP_000143859.1.100284 WP_000143859.1.100313 WP_000143859.1.100314 WP_000143859.1.100321 WP_000143859.1.100354 WP_000143859.1.100376 WP_000143859.1.100392 WP_000143859.1.100412 WP_000143859.1.100421 WP_000143859.1.100424 WP_000143859.1.100432 WP_000143859.1.100436 WP_000143859.1.100438 WP_000143859.1.100446 WP_000143859.1.100450 WP_000143859.1.100457 WP_000143859.1.100472 WP_000143859.1.100484 WP_000143859.1.100488 WP_000143859.1.100502 WP_000143859.1.100521 WP_000143859.1.100557 WP_000143859.1.100584 WP_000143859.1.100589 WP_000143859.1.100592 WP_000143859.1.100597 WP_000143859.1.100605 WP_000143859.1.100610 WP_000143859.1.100642 WP_000143859.1.10065 WP_000143859.1.100650 WP_000143859.1.100707 WP_000143859.1.100711 WP_000143859.1.100714 WP_000143859.1.100730 WP_000143859.1.100732 WP_000143859.1.100733 WP_000143859.1.100739 WP_000143859.1.100750 WP_000143859.1.10076 WP_000143859.1.100764 WP_000143859.1.100773 WP_000143859.1.100776 WP_000143859.1.100781 WP_000143859.1.100793 WP_000143859.1.100799 WP_000143859.1.10081 WP_000143859.1.100857 WP_000143859.1.100865 WP_000143859.1.100869 WP_000143859.1.100871 WP_000143859.1.100882 WP_000143859.1.100886 WP_000143859.1.100941 WP_000143859.1.100948 WP_000143859.1.100953 WP_000143859.1.101011 WP_000143859.1.101020 WP_000143859.1.101074 WP_000143859.1.101078 WP_000143859.1.10108 WP_000143859.1.101094 WP_000143859.1.101112 WP_000143859.1.101180 WP_000143859.1.101223 WP_000143859.1.101226 WP_000143859.1.10124 WP_000143859.1.101259 WP_000143859.1.101271 WP_000143859.1.101284 WP_000143859.1.101291 WP_000143859.1.1013 WP_000143859.1.101312 WP_000143859.1.101320 WP_000143859.1.101322 WP_000143859.1.101353 WP_000143859.1.101374 WP_000143859.1.101386 WP_000143859.1.101404 WP_000143859.1.101420 WP_000143859.1.101425 WP_000143859.1.101473 WP_000143859.1.101520 WP_000143859.1.101589 WP_000143859.1.101609 WP_000143859.1.101616 WP_000143859.1.101634 WP_000143859.1.101639 WP_000143859.1.101666 WP_000143859.1.101674 WP_000143859.1.101707 WP_000143859.1.101734 WP_000143859.1.101740 WP_000143859.1.101759 WP_000143859.1.101776 WP_000143859.1.101815 WP_000143859.1.101832 WP_000143859.1.101868 WP_000143859.1.101878 WP_000143859.1.101890 WP_000143859.1.101941 WP_000143859.1.101953 WP_000143859.1.102009 WP_000143859.1.102050 WP_000143859.1.102087 WP_000143859.1.102103 WP_000143859.1.102111 WP_000143859.1.10220 WP_000143859.1.10231 WP_000143859.1.10266 WP_000143859.1.10276 WP_000143859.1.10293 WP_000143859.1.10300 WP_000143859.1.10310 WP_000143859.1.10338 WP_000143859.1.1038 WP_000143859.1.10394 WP_000143859.1.104 WP_000143859.1.10401 WP_000143859.1.10428 WP_000143859.1.10429 WP_000143859.1.10439 WP_000143859.1.10459 WP_000143859.1.10475 WP_000143859.1.10498 WP_000143859.1.10511 WP_000143859.1.10514 WP_000143859.1.10530 WP_000143859.1.10532 WP_000143859.1.10547 WP_000143859.1.10562 WP_000143859.1.10566 WP_000143859.1.10595 WP_000143859.1.106 WP_000143859.1.10631 WP_000143859.1.10642 WP_000143859.1.10654 WP_000143859.1.10675 WP_000143859.1.10677 WP_000143859.1.10678 WP_000143859.1.10753 WP_000143859.1.10755 WP_000143859.1.10857 WP_000143859.1.10868 WP_000143859.1.10873 WP_000143859.1.10898 WP_000143859.1.10926 WP_000143859.1.10936 WP_000143859.1.10992 WP_000143859.1.11000 WP_000143859.1.11012 WP_000143859.1.11024 WP_000143859.1.11031 WP_000143859.1.11041 WP_000143859.1.11055 WP_000143859.1.11098 WP_000143859.1.1110 WP_000143859.1.11126 WP_000143859.1.11142 WP_000143859.1.11156 WP_000143859.1.11168 WP_000143859.1.11190 WP_000143859.1.11213 WP_000143859.1.11216 WP_000143859.1.11239 WP_000143859.1.11253 WP_000143859.1.11295 WP_000143859.1.113 WP_000143859.1.11304 WP_000143859.1.11314 WP_000143859.1.1135 WP_000143859.1.11362 WP_000143859.1.11385 WP_000143859.1.1142 WP_000143859.1.11426 WP_000143859.1.11429 WP_000143859.1.11455 WP_000143859.1.11458 WP_000143859.1.11479 WP_000143859.1.1150 WP_000143859.1.11511 WP_000143859.1.11518 WP_000143859.1.11526 WP_000143859.1.11528 WP_000143859.1.11532 WP_000143859.1.11543 WP_000143859.1.11557 WP_000143859.1.1156 WP_000143859.1.11567 WP_000143859.1.11588 WP_000143859.1.11603 WP_000143859.1.11638 WP_000143859.1.11677 WP_000143859.1.11681 WP_000143859.1.11687 WP_000143859.1.1169 WP_000143859.1.11735 WP_000143859.1.1174 WP_000143859.1.11763 WP_000143859.1.11772 WP_000143859.1.11824 WP_000143859.1.11834 WP_000143859.1.11841 WP_000143859.1.11865 WP_000143859.1.11883 WP_000143859.1.11897 WP_000143859.1.11900 WP_000143859.1.11908 WP_000143859.1.11914 WP_000143859.1.11936 WP_000143859.1.11978 WP_000143859.1.12007 WP_000143859.1.12017 WP_000143859.1.12025 WP_000143859.1.12027 WP_000143859.1.12040 WP_000143859.1.12047 WP_000143859.1.12061 WP_000143859.1.1207 WP_000143859.1.12106 WP_000143859.1.12114 WP_000143859.1.12141 WP_000143859.1.12144 WP_000143859.1.1215 WP_000143859.1.12168 WP_000143859.1.12172 WP_000143859.1.12192 WP_000143859.1.1224 WP_000143859.1.12244 WP_000143859.1.12280 WP_000143859.1.12282 WP_000143859.1.12340 WP_000143859.1.12351 WP_000143859.1.12364 WP_000143859.1.12370 WP_000143859.1.12374 WP_000143859.1.12396 WP_000143859.1.12398 WP_000143859.1.12441 WP_000143859.1.12456 WP_000143859.1.1246 WP_000143859.1.12484 WP_000143859.1.12485 WP_000143859.1.1250 WP_000143859.1.12546 WP_000143859.1.12568 WP_000143859.1.12569 WP_000143859.1.12581 WP_000143859.1.12584 WP_000143859.1.12585 WP_000143859.1.12620 WP_000143859.1.1264 WP_000143859.1.12648 WP_000143859.1.12683 WP_000143859.1.12696 WP_000143859.1.12726 WP_000143859.1.12727 WP_000143859.1.12728 WP_000143859.1.12741 WP_000143859.1.12834 WP_000143859.1.12864 WP_000143859.1.12877 WP_000143859.1.12879 WP_000143859.1.12936 WP_000143859.1.1299 WP_000143859.1.12995 WP_000143859.1.1300 WP_000143859.1.13027 WP_000143859.1.13076 WP_000143859.1.13101 WP_000143859.1.13106 WP_000143859.1.13108 WP_000143859.1.13130 WP_000143859.1.13161 WP_000143859.1.13207 WP_000143859.1.1321 WP_000143859.1.13247 WP_000143859.1.1326 WP_000143859.1.13268 WP_000143859.1.13274 WP_000143859.1.13291 WP_000143859.1.133 WP_000143859.1.13311 WP_000143859.1.13314 WP_000143859.1.13334 WP_000143859.1.13338 WP_000143859.1.13342 WP_000143859.1.13352 WP_000143859.1.13367 WP_000143859.1.13391 WP_000143859.1.13406 WP_000143859.1.13414 WP_000143859.1.13440 WP_000143859.1.13443 WP_000143859.1.13476 WP_000143859.1.13488 WP_000143859.1.13509 WP_000143859.1.13543 WP_000143859.1.13573 WP_000143859.1.13599 WP_000143859.1.13625 WP_000143859.1.13661 WP_000143859.1.13669 WP_000143859.1.13677 WP_000143859.1.13686 WP_000143859.1.13691 WP_000143859.1.1372 WP_000143859.1.13732 WP_000143859.1.13741 WP_000143859.1.13750 WP_000143859.1.1382 WP_000143859.1.13848 WP_000143859.1.1387 WP_000143859.1.13908 WP_000143859.1.13932 WP_000143859.1.13968 WP_000143859.1.1397 WP_000143859.1.13972 WP_000143859.1.140 WP_000143859.1.14001 WP_000143859.1.1401 WP_000143859.1.14011 WP_000143859.1.14041 WP_000143859.1.1408 WP_000143859.1.14089 WP_000143859.1.14099 WP_000143859.1.14111 WP_000143859.1.1412 WP_000143859.1.14120 WP_000143859.1.14123 WP_000143859.1.14150 WP_000143859.1.14151 WP_000143859.1.14191 WP_000143859.1.14197 WP_000143859.1.14212 WP_000143859.1.14239 WP_000143859.1.14280 WP_000143859.1.14286 WP_000143859.1.14320 WP_000143859.1.14333 WP_000143859.1.14379 WP_000143859.1.14399 WP_000143859.1.14406 WP_000143859.1.14410 WP_000143859.1.14436 WP_000143859.1.14444 WP_000143859.1.14446 WP_000143859.1.14458 WP_000143859.1.14466 WP_000143859.1.14467 WP_000143859.1.14474 WP_000143859.1.14500 WP_000143859.1.14505 WP_000143859.1.14516 WP_000143859.1.14519 WP_000143859.1.14524 WP_000143859.1.14526 WP_000143859.1.14550 WP_000143859.1.14554 WP_000143859.1.14575 WP_000143859.1.146 WP_000143859.1.14618 WP_000143859.1.14688 WP_000143859.1.14701 WP_000143859.1.14703 WP_000143859.1.14708 WP_000143859.1.14719 WP_000143859.1.14725 WP_000143859.1.1473 WP_000143859.1.14737 WP_000143859.1.14765 WP_000143859.1.14810 WP_000143859.1.14819 WP_000143859.1.14852 WP_000143859.1.14877 WP_000143859.1.14884 WP_000143859.1.1489 WP_000143859.1.14894 WP_000143859.1.14913 WP_000143859.1.14917 WP_000143859.1.14927 WP_000143859.1.14930 WP_000143859.1.14932 WP_000143859.1.14947 WP_000143859.1.14948 WP_000143859.1.15046 WP_000143859.1.15059 WP_000143859.1.15067 WP_000143859.1.15079 WP_000143859.1.15100 WP_000143859.1.15124 WP_000143859.1.15184 WP_000143859.1.15223 WP_000143859.1.15226 WP_000143859.1.15244 WP_000143859.1.15265 WP_000143859.1.15276 WP_000143859.1.15316 WP_000143859.1.15318 WP_000143859.1.15353 WP_000143859.1.15362 WP_000143859.1.15369 WP_000143859.1.1540 WP_000143859.1.15415 WP_000143859.1.15423 WP_000143859.1.15433 WP_000143859.1.15439 WP_000143859.1.15483 WP_000143859.1.15487 WP_000143859.1.15508 WP_000143859.1.15535 WP_000143859.1.15581 WP_000143859.1.15585 WP_000143859.1.15586 WP_000143859.1.15597 WP_000143859.1.15612 WP_000143859.1.15616 WP_000143859.1.15625 WP_000143859.1.1568 WP_000143859.1.15708 WP_000143859.1.15710 WP_000143859.1.15717 WP_000143859.1.15777 WP_000143859.1.15784 WP_000143859.1.15830 WP_000143859.1.15835 WP_000143859.1.15862 WP_000143859.1.15905 WP_000143859.1.15909 WP_000143859.1.15910 WP_000143859.1.15912 WP_000143859.1.1592 WP_000143859.1.15922 WP_000143859.1.15970 WP_000143859.1.15986 WP_000143859.1.16004 WP_000143859.1.16006 WP_000143859.1.16032 WP_000143859.1.16046 WP_000143859.1.16047 WP_000143859.1.16051 WP_000143859.1.16058 WP_000143859.1.16062 WP_000143859.1.16063 WP_000143859.1.16103 WP_000143859.1.16150 WP_000143859.1.16155 WP_000143859.1.16201 WP_000143859.1.16226 WP_000143859.1.16233 WP_000143859.1.1626 WP_000143859.1.16264 WP_000143859.1.16273 WP_000143859.1.16284 WP_000143859.1.16328 WP_000143859.1.16331 WP_000143859.1.16344 WP_000143859.1.1635 WP_000143859.1.16361 WP_000143859.1.16363 WP_000143859.1.16365 WP_000143859.1.16366 WP_000143859.1.16452 WP_000143859.1.16453 WP_000143859.1.16461 WP_000143859.1.16462 WP_000143859.1.16465 WP_000143859.1.16468 WP_000143859.1.16474 WP_000143859.1.16508 WP_000143859.1.16522 WP_000143859.1.16525 WP_000143859.1.16565 WP_000143859.1.16581 WP_000143859.1.16588 WP_000143859.1.16614 WP_000143859.1.16650 WP_000143859.1.16658 WP_000143859.1.16666 WP_000143859.1.16673 WP_000143859.1.1668 WP_000143859.1.16686 WP_000143859.1.16691 WP_000143859.1.167 WP_000143859.1.16729 WP_000143859.1.16732 WP_000143859.1.16735 WP_000143859.1.16736 WP_000143859.1.1674 WP_000143859.1.16767 WP_000143859.1.16781 WP_000143859.1.16786 WP_000143859.1.16819 WP_000143859.1.16855 WP_000143859.1.16858 WP_000143859.1.16873 WP_000143859.1.16879 WP_000143859.1.1689 WP_000143859.1.16893 WP_000143859.1.16896 WP_000143859.1.16903 WP_000143859.1.16905 WP_000143859.1.16910 WP_000143859.1.16941 WP_000143859.1.16942 WP_000143859.1.16944 WP_000143859.1.16948 WP_000143859.1.16965 WP_000143859.1.16972 WP_000143859.1.16998 WP_000143859.1.1700 WP_000143859.1.17031 WP_000143859.1.17049 WP_000143859.1.17058 WP_000143859.1.17060 WP_000143859.1.17078 WP_000143859.1.17093 WP_000143859.1.17096 WP_000143859.1.17105 WP_000143859.1.17188 WP_000143859.1.17202 WP_000143859.1.17219 WP_000143859.1.1722 WP_000143859.1.17285 WP_000143859.1.17302 WP_000143859.1.17307 WP_000143859.1.17308 WP_000143859.1.1733 WP_000143859.1.17368 WP_000143859.1.1737 WP_000143859.1.174 WP_000143859.1.17405 WP_000143859.1.17406 WP_000143859.1.17447 WP_000143859.1.17480 WP_000143859.1.17482 WP_000143859.1.17504 WP_000143859.1.17513 WP_000143859.1.17543 WP_000143859.1.17546 WP_000143859.1.17563 WP_000143859.1.17578 WP_000143859.1.17583 WP_000143859.1.17622 WP_000143859.1.17629 WP_000143859.1.17659 WP_000143859.1.17667 WP_000143859.1.17686 WP_000143859.1.17702 WP_000143859.1.17705 WP_000143859.1.17732 WP_000143859.1.17741 WP_000143859.1.17743 WP_000143859.1.17755 WP_000143859.1.17840 WP_000143859.1.17886 WP_000143859.1.17891 WP_000143859.1.17914 WP_000143859.1.17919 WP_000143859.1.17936 WP_000143859.1.17956 WP_000143859.1.1798 WP_000143859.1.17991 WP_000143859.1.18005 WP_000143859.1.1801 WP_000143859.1.18019 WP_000143859.1.18021 WP_000143859.1.18056 WP_000143859.1.18061 WP_000143859.1.18089 WP_000143859.1.18092 WP_000143859.1.18099 WP_000143859.1.18109 WP_000143859.1.18111 WP_000143859.1.18122 WP_000143859.1.18124 WP_000143859.1.1814 WP_000143859.1.18144 WP_000143859.1.18149 WP_000143859.1.18163 WP_000143859.1.18173 WP_000143859.1.1818 WP_000143859.1.18192 WP_000143859.1.18249 WP_000143859.1.18254 WP_000143859.1.18265 WP_000143859.1.18267 WP_000143859.1.18270 WP_000143859.1.18280 WP_000143859.1.18281 WP_000143859.1.18282 WP_000143859.1.18328 WP_000143859.1.18358 WP_000143859.1.18365 WP_000143859.1.18370 WP_000143859.1.18384 WP_000143859.1.18406 WP_000143859.1.18426 WP_000143859.1.18468 WP_000143859.1.18474 WP_000143859.1.18485 WP_000143859.1.18513 WP_000143859.1.18607 WP_000143859.1.18610 WP_000143859.1.18641 WP_000143859.1.18678 WP_000143859.1.18705 WP_000143859.1.18715 WP_000143859.1.18722 WP_000143859.1.18766 WP_000143859.1.18776 WP_000143859.1.1880 WP_000143859.1.18822 WP_000143859.1.18847 WP_000143859.1.1885 WP_000143859.1.18860 WP_000143859.1.18881 WP_000143859.1.18886 WP_000143859.1.18895 WP_000143859.1.18922 WP_000143859.1.18940 WP_000143859.1.18949 WP_000143859.1.1895 WP_000143859.1.18959 WP_000143859.1.1897 WP_000143859.1.19001 WP_000143859.1.19006 WP_000143859.1.19030 WP_000143859.1.19038 WP_000143859.1.19044 WP_000143859.1.19053 WP_000143859.1.19064 WP_000143859.1.19084 WP_000143859.1.19093 WP_000143859.1.19187 WP_000143859.1.19228 WP_000143859.1.19240 WP_000143859.1.19273 WP_000143859.1.19288 WP_000143859.1.19300 WP_000143859.1.19320 WP_000143859.1.19373 WP_000143859.1.1939 WP_000143859.1.19422 WP_000143859.1.19433 WP_000143859.1.19454 WP_000143859.1.19456 WP_000143859.1.19458 WP_000143859.1.19460 WP_000143859.1.19461 WP_000143859.1.19496 WP_000143859.1.19535 WP_000143859.1.19538 WP_000143859.1.1954 WP_000143859.1.1955 WP_000143859.1.19588 WP_000143859.1.19589 WP_000143859.1.19614 WP_000143859.1.19616 WP_000143859.1.19642 WP_000143859.1.19656 WP_000143859.1.19660 WP_000143859.1.19663 WP_000143859.1.19683 WP_000143859.1.19686 WP_000143859.1.19702 WP_000143859.1.19706 WP_000143859.1.19724 WP_000143859.1.19731 WP_000143859.1.19749 WP_000143859.1.19784 WP_000143859.1.19793 WP_000143859.1.19794 WP_000143859.1.19802 WP_000143859.1.19809 WP_000143859.1.19834 WP_000143859.1.19863 WP_000143859.1.19867 WP_000143859.1.19884 WP_000143859.1.1992 WP_000143859.1.19970 WP_000143859.1.19975 WP_000143859.1.1998 WP_000143859.1.19987 WP_000143859.1.19999 WP_000143859.1.20 WP_000143859.1.20023 WP_000143859.1.20086 WP_000143859.1.20091 WP_000143859.1.2010 WP_000143859.1.20119 WP_000143859.1.20212 WP_000143859.1.20218 WP_000143859.1.20254 WP_000143859.1.20255 WP_000143859.1.2026 WP_000143859.1.20261 WP_000143859.1.20266 WP_000143859.1.20271 WP_000143859.1.20296 WP_000143859.1.20330 WP_000143859.1.20339 WP_000143859.1.2036 WP_000143859.1.20362 WP_000143859.1.20364 WP_000143859.1.20376 WP_000143859.1.20391 WP_000143859.1.2041 WP_000143859.1.20418 WP_000143859.1.20419 WP_000143859.1.20425 WP_000143859.1.20437 WP_000143859.1.20443 WP_000143859.1.20446 WP_000143859.1.20465 WP_000143859.1.20492 WP_000143859.1.20525 WP_000143859.1.2053 WP_000143859.1.2054 WP_000143859.1.20614 WP_000143859.1.20626 WP_000143859.1.20635 WP_000143859.1.20646 WP_000143859.1.20695 WP_000143859.1.20700 WP_000143859.1.20718 WP_000143859.1.20721 WP_000143859.1.2073 WP_000143859.1.20740 WP_000143859.1.20760 WP_000143859.1.20787 WP_000143859.1.20789 WP_000143859.1.20828 WP_000143859.1.20839 WP_000143859.1.2087 WP_000143859.1.20883 WP_000143859.1.20886 WP_000143859.1.20894 WP_000143859.1.20908 WP_000143859.1.20947 WP_000143859.1.20953 WP_000143859.1.21010 WP_000143859.1.21049 WP_000143859.1.2106 WP_000143859.1.21062 WP_000143859.1.21075 WP_000143859.1.21079 WP_000143859.1.21089 WP_000143859.1.21103 WP_000143859.1.21136 WP_000143859.1.21144 WP_000143859.1.21146 WP_000143859.1.2116 WP_000143859.1.21162 WP_000143859.1.21181 WP_000143859.1.21184 WP_000143859.1.21185 WP_000143859.1.21194 WP_000143859.1.21202 WP_000143859.1.21241 WP_000143859.1.21245 WP_000143859.1.21246 WP_000143859.1.21260 WP_000143859.1.21269 WP_000143859.1.21332 WP_000143859.1.21351 WP_000143859.1.21362 WP_000143859.1.21366 WP_000143859.1.21400 WP_000143859.1.21404 WP_000143859.1.21423 WP_000143859.1.21453 WP_000143859.1.21492 WP_000143859.1.21497 WP_000143859.1.21499 WP_000143859.1.21603 WP_000143859.1.2166 WP_000143859.1.21674 WP_000143859.1.21681 WP_000143859.1.21692 WP_000143859.1.21715 WP_000143859.1.21728 WP_000143859.1.21730 WP_000143859.1.21751 WP_000143859.1.21757 WP_000143859.1.21792 WP_000143859.1.21877 WP_000143859.1.21886 WP_000143859.1.21909 WP_000143859.1.21940 WP_000143859.1.21946 WP_000143859.1.21950 WP_000143859.1.21966 WP_000143859.1.21981 WP_000143859.1.21991 WP_000143859.1.22024 WP_000143859.1.22030 WP_000143859.1.2205 WP_000143859.1.22051 WP_000143859.1.22062 WP_000143859.1.22064 WP_000143859.1.22067 WP_000143859.1.22096 WP_000143859.1.22118 WP_000143859.1.22126 WP_000143859.1.22136 WP_000143859.1.2216 WP_000143859.1.22162 WP_000143859.1.22208 WP_000143859.1.2221 WP_000143859.1.22235 WP_000143859.1.2227 WP_000143859.1.22323 WP_000143859.1.22337 WP_000143859.1.22346 WP_000143859.1.2235 WP_000143859.1.22373 WP_000143859.1.22379 WP_000143859.1.22427 WP_000143859.1.22449 WP_000143859.1.22454 WP_000143859.1.2246 WP_000143859.1.22476 WP_000143859.1.22485 WP_000143859.1.22514 WP_000143859.1.22537 WP_000143859.1.22575 WP_000143859.1.22582 WP_000143859.1.22595 WP_000143859.1.22605 WP_000143859.1.22614 WP_000143859.1.22620 WP_000143859.1.22652 WP_000143859.1.22676 WP_000143859.1.22683 WP_000143859.1.22692 WP_000143859.1.22758 WP_000143859.1.22760 WP_000143859.1.2283 WP_000143859.1.2284 WP_000143859.1.22855 WP_000143859.1.22857 WP_000143859.1.22864 WP_000143859.1.22870 WP_000143859.1.22880 WP_000143859.1.22895 WP_000143859.1.22902 WP_000143859.1.22926 WP_000143859.1.22943 WP_000143859.1.22947 WP_000143859.1.22967 WP_000143859.1.22979 WP_000143859.1.23040 WP_000143859.1.23053 WP_000143859.1.23058 WP_000143859.1.23102 WP_000143859.1.23114 WP_000143859.1.2314 WP_000143859.1.23148 WP_000143859.1.23155 WP_000143859.1.23169 WP_000143859.1.23172 WP_000143859.1.23192 WP_000143859.1.23218 WP_000143859.1.2324 WP_000143859.1.23259 WP_000143859.1.23274 WP_000143859.1.23279 WP_000143859.1.23309 WP_000143859.1.2331 WP_000143859.1.2332 WP_000143859.1.23329 WP_000143859.1.23340 WP_000143859.1.2336 WP_000143859.1.23365 WP_000143859.1.23379 WP_000143859.1.23409 WP_000143859.1.23412 WP_000143859.1.23426 WP_000143859.1.23442 WP_000143859.1.23460 WP_000143859.1.23472 WP_000143859.1.23482 WP_000143859.1.23492 WP_000143859.1.235 WP_000143859.1.23509 WP_000143859.1.23515 WP_000143859.1.23529 WP_000143859.1.23548 WP_000143859.1.23571 WP_000143859.1.2358 WP_000143859.1.23604 WP_000143859.1.23621 WP_000143859.1.23631 WP_000143859.1.23634 WP_000143859.1.23639 WP_000143859.1.2364 WP_000143859.1.23643 WP_000143859.1.23670 WP_000143859.1.23679 WP_000143859.1.23685 WP_000143859.1.23707 WP_000143859.1.23728 WP_000143859.1.23736 WP_000143859.1.23746 WP_000143859.1.2375 WP_000143859.1.23755 WP_000143859.1.23783 WP_000143859.1.23786 WP_000143859.1.23787 WP_000143859.1.23801 WP_000143859.1.23819 WP_000143859.1.23932 WP_000143859.1.23959 WP_000143859.1.24017 WP_000143859.1.24028 WP_000143859.1.24061 WP_000143859.1.24082 WP_000143859.1.24083 WP_000143859.1.24117 WP_000143859.1.24125 WP_000143859.1.24138 WP_000143859.1.24145 WP_000143859.1.24153 WP_000143859.1.24163 WP_000143859.1.24206 WP_000143859.1.24214 WP_000143859.1.24250 WP_000143859.1.24291 WP_000143859.1.24297 WP_000143859.1.24308 WP_000143859.1.24322 WP_000143859.1.24355 WP_000143859.1.24361 WP_000143859.1.24375 WP_000143859.1.24376 WP_000143859.1.24400 WP_000143859.1.24408 WP_000143859.1.24409 WP_000143859.1.24420 WP_000143859.1.24433 WP_000143859.1.24444 WP_000143859.1.24450 WP_000143859.1.24476 WP_000143859.1.24494 WP_000143859.1.24555 WP_000143859.1.24567 WP_000143859.1.24578 WP_000143859.1.24619 WP_000143859.1.24643 WP_000143859.1.24673 WP_000143859.1.24688 WP_000143859.1.24689 WP_000143859.1.24716 WP_000143859.1.24723 WP_000143859.1.24727 WP_000143859.1.24737 WP_000143859.1.24779 WP_000143859.1.2481 WP_000143859.1.24832 WP_000143859.1.24901 WP_000143859.1.24944 WP_000143859.1.24964 WP_000143859.1.25008 WP_000143859.1.25015 WP_000143859.1.25017 WP_000143859.1.25032 WP_000143859.1.25036 WP_000143859.1.25041 WP_000143859.1.25053 WP_000143859.1.25072 WP_000143859.1.25119 WP_000143859.1.25130 WP_000143859.1.25140 WP_000143859.1.25175 WP_000143859.1.25185 WP_000143859.1.25196 WP_000143859.1.25206 WP_000143859.1.25210 WP_000143859.1.25217 WP_000143859.1.25219 WP_000143859.1.25229 WP_000143859.1.25297 WP_000143859.1.25304 WP_000143859.1.25354 WP_000143859.1.25374 WP_000143859.1.25405 WP_000143859.1.25426 WP_000143859.1.25454 WP_000143859.1.25475 WP_000143859.1.25490 WP_000143859.1.25493 WP_000143859.1.25498 WP_000143859.1.25508 WP_000143859.1.25512 WP_000143859.1.2554 WP_000143859.1.25546 WP_000143859.1.25596 WP_000143859.1.25603 WP_000143859.1.25618 WP_000143859.1.2562 WP_000143859.1.25666 WP_000143859.1.25668 WP_000143859.1.25690 WP_000143859.1.2570 WP_000143859.1.25700 WP_000143859.1.25703 WP_000143859.1.25708 WP_000143859.1.25722 WP_000143859.1.25740 WP_000143859.1.25780 WP_000143859.1.25807 WP_000143859.1.25809 WP_000143859.1.2581 WP_000143859.1.25814 WP_000143859.1.25821 WP_000143859.1.25833 WP_000143859.1.25835 WP_000143859.1.25882 WP_000143859.1.25911 WP_000143859.1.25932 WP_000143859.1.25951 WP_000143859.1.25962 WP_000143859.1.25963 WP_000143859.1.25988 WP_000143859.1.26001 WP_000143859.1.26027 WP_000143859.1.26030 WP_000143859.1.26034 WP_000143859.1.26075 WP_000143859.1.26083 WP_000143859.1.26107 WP_000143859.1.2615 WP_000143859.1.26213 WP_000143859.1.26217 WP_000143859.1.26230 WP_000143859.1.26232 WP_000143859.1.26269 WP_000143859.1.26272 WP_000143859.1.26282 WP_000143859.1.26286 WP_000143859.1.26288 WP_000143859.1.26311 WP_000143859.1.26319 WP_000143859.1.2634 WP_000143859.1.26363 WP_000143859.1.26384 WP_000143859.1.26394 WP_000143859.1.26426 WP_000143859.1.26429 WP_000143859.1.26440 WP_000143859.1.26441 WP_000143859.1.26491 WP_000143859.1.26493 WP_000143859.1.26512 WP_000143859.1.2654 WP_000143859.1.26551 WP_000143859.1.26554 WP_000143859.1.26567 WP_000143859.1.26576 WP_000143859.1.26582 WP_000143859.1.2660 WP_000143859.1.26636 WP_000143859.1.2667 WP_000143859.1.26687 WP_000143859.1.26689 WP_000143859.1.2672 WP_000143859.1.26741 WP_000143859.1.2679 WP_000143859.1.26794 WP_000143859.1.26856 WP_000143859.1.26908 WP_000143859.1.26919 WP_000143859.1.2692 WP_000143859.1.26928 WP_000143859.1.26936 WP_000143859.1.270 WP_000143859.1.27008 WP_000143859.1.27010 WP_000143859.1.27027 WP_000143859.1.27051 WP_000143859.1.27055 WP_000143859.1.27070 WP_000143859.1.27077 WP_000143859.1.27084 WP_000143859.1.27086 WP_000143859.1.27087 WP_000143859.1.27111 WP_000143859.1.27115 WP_000143859.1.2713 WP_000143859.1.27169 WP_000143859.1.2717 WP_000143859.1.27173 WP_000143859.1.27206 WP_000143859.1.27223 WP_000143859.1.27228 WP_000143859.1.27272 WP_000143859.1.27282 WP_000143859.1.27285 WP_000143859.1.27309 WP_000143859.1.27314 WP_000143859.1.27329 WP_000143859.1.27361 WP_000143859.1.27383 WP_000143859.1.27419 WP_000143859.1.27423 WP_000143859.1.27452 WP_000143859.1.27544 WP_000143859.1.27547 WP_000143859.1.27556 WP_000143859.1.27561 WP_000143859.1.27565 WP_000143859.1.27595 WP_000143859.1.27598 WP_000143859.1.2763 WP_000143859.1.27632 WP_000143859.1.27638 WP_000143859.1.27658 WP_000143859.1.27665 WP_000143859.1.27706 WP_000143859.1.27707 WP_000143859.1.27713 WP_000143859.1.27755 WP_000143859.1.27761 WP_000143859.1.2777 WP_000143859.1.27775 WP_000143859.1.27776 WP_000143859.1.27785 WP_000143859.1.27798 WP_000143859.1.27815 WP_000143859.1.27833 WP_000143859.1.27857 WP_000143859.1.27883 WP_000143859.1.27900 WP_000143859.1.27928 WP_000143859.1.27945 WP_000143859.1.27969 WP_000143859.1.27977 WP_000143859.1.27995 WP_000143859.1.27997 WP_000143859.1.28004 WP_000143859.1.28032 WP_000143859.1.28037 WP_000143859.1.2809 WP_000143859.1.28094 WP_000143859.1.28116 WP_000143859.1.28126 WP_000143859.1.28139 WP_000143859.1.28155 WP_000143859.1.28170 WP_000143859.1.28198 WP_000143859.1.28200 WP_000143859.1.2822 WP_000143859.1.28225 WP_000143859.1.28229 WP_000143859.1.28232 WP_000143859.1.28233 WP_000143859.1.28267 WP_000143859.1.28302 WP_000143859.1.28303 WP_000143859.1.2835 WP_000143859.1.28384 WP_000143859.1.28386 WP_000143859.1.28393 WP_000143859.1.28395 WP_000143859.1.284 WP_000143859.1.2845 WP_000143859.1.28462 WP_000143859.1.28479 WP_000143859.1.2853 WP_000143859.1.28538 WP_000143859.1.28570 WP_000143859.1.28575 WP_000143859.1.28612 WP_000143859.1.28620 WP_000143859.1.28625 WP_000143859.1.28627 WP_000143859.1.28655 WP_000143859.1.28692 WP_000143859.1.28694 WP_000143859.1.287 WP_000143859.1.2873 WP_000143859.1.28773 WP_000143859.1.28775 WP_000143859.1.2879 WP_000143859.1.28830 WP_000143859.1.2890 WP_000143859.1.28917 WP_000143859.1.28921 WP_000143859.1.28938 WP_000143859.1.28946 WP_000143859.1.28962 WP_000143859.1.29006 WP_000143859.1.29010 WP_000143859.1.29023 WP_000143859.1.29042 WP_000143859.1.2905 WP_000143859.1.2907 WP_000143859.1.29081 WP_000143859.1.29089 WP_000143859.1.29099 WP_000143859.1.2910 WP_000143859.1.29113 WP_000143859.1.29130 WP_000143859.1.29153 WP_000143859.1.29168 WP_000143859.1.29203 WP_000143859.1.29218 WP_000143859.1.29237 WP_000143859.1.2924 WP_000143859.1.29248 WP_000143859.1.29255 WP_000143859.1.29265 WP_000143859.1.29288 WP_000143859.1.2932 WP_000143859.1.29379 WP_000143859.1.29389 WP_000143859.1.29422 WP_000143859.1.29436 WP_000143859.1.29439 WP_000143859.1.2946 WP_000143859.1.29462 WP_000143859.1.29509 WP_000143859.1.29563 WP_000143859.1.29588 WP_000143859.1.29593 WP_000143859.1.29601 WP_000143859.1.29606 WP_000143859.1.29615 WP_000143859.1.29619 WP_000143859.1.29704 WP_000143859.1.29727 WP_000143859.1.29743 WP_000143859.1.29782 WP_000143859.1.29827 WP_000143859.1.29833 WP_000143859.1.2984 WP_000143859.1.29845 WP_000143859.1.29851 WP_000143859.1.29865 WP_000143859.1.29886 WP_000143859.1.29898 WP_000143859.1.29919 WP_000143859.1.2994 WP_000143859.1.29964 WP_000143859.1.29969 WP_000143859.1.29983 WP_000143859.1.29990 WP_000143859.1.30006 WP_000143859.1.30009 WP_000143859.1.30013 WP_000143859.1.30018 WP_000143859.1.3002 WP_000143859.1.30022 WP_000143859.1.30027 WP_000143859.1.30034 WP_000143859.1.30049 WP_000143859.1.3005 WP_000143859.1.30058 WP_000143859.1.30059 WP_000143859.1.30093 WP_000143859.1.30165 WP_000143859.1.3017 WP_000143859.1.30172 WP_000143859.1.30185 WP_000143859.1.30202 WP_000143859.1.30210 WP_000143859.1.30213 WP_000143859.1.30354 WP_000143859.1.30357 WP_000143859.1.30362 WP_000143859.1.30386 WP_000143859.1.30389 WP_000143859.1.3042 WP_000143859.1.30421 WP_000143859.1.30437 WP_000143859.1.30440 WP_000143859.1.30448 WP_000143859.1.30469 WP_000143859.1.30489 WP_000143859.1.30492 WP_000143859.1.30505 WP_000143859.1.30507 WP_000143859.1.30517 WP_000143859.1.30535 WP_000143859.1.30542 WP_000143859.1.30544 WP_000143859.1.30547 WP_000143859.1.30548 WP_000143859.1.30556 WP_000143859.1.30572 WP_000143859.1.30585 WP_000143859.1.30589 WP_000143859.1.30602 WP_000143859.1.30618 WP_000143859.1.30627 WP_000143859.1.30664 WP_000143859.1.30688 WP_000143859.1.30752 WP_000143859.1.30794 WP_000143859.1.30803 WP_000143859.1.30806 WP_000143859.1.30819 WP_000143859.1.30833 WP_000143859.1.30835 WP_000143859.1.3089 WP_000143859.1.30909 WP_000143859.1.30934 WP_000143859.1.3095 WP_000143859.1.30967 WP_000143859.1.30968 WP_000143859.1.30972 WP_000143859.1.31 WP_000143859.1.31001 WP_000143859.1.31042 WP_000143859.1.31046 WP_000143859.1.31066 WP_000143859.1.31078 WP_000143859.1.31086 WP_000143859.1.31092 WP_000143859.1.31111 WP_000143859.1.31122 WP_000143859.1.3113 WP_000143859.1.31139 WP_000143859.1.31145 WP_000143859.1.31167 WP_000143859.1.31182 WP_000143859.1.31185 WP_000143859.1.3119 WP_000143859.1.31190 WP_000143859.1.31195 WP_000143859.1.31196 WP_000143859.1.31205 WP_000143859.1.3121 WP_000143859.1.31210 WP_000143859.1.31214 WP_000143859.1.31219 WP_000143859.1.31223 WP_000143859.1.3124 WP_000143859.1.31251 WP_000143859.1.3127 WP_000143859.1.31272 WP_000143859.1.31281 WP_000143859.1.31303 WP_000143859.1.3131 WP_000143859.1.31335 WP_000143859.1.31352 WP_000143859.1.31362 WP_000143859.1.31389 WP_000143859.1.31413 WP_000143859.1.31446 WP_000143859.1.31451 WP_000143859.1.31476 WP_000143859.1.31504 WP_000143859.1.31515 WP_000143859.1.31533 WP_000143859.1.31578 WP_000143859.1.31585 WP_000143859.1.31658 WP_000143859.1.3167 WP_000143859.1.31762 WP_000143859.1.31799 WP_000143859.1.31836 WP_000143859.1.31901 WP_000143859.1.31927 WP_000143859.1.31940 WP_000143859.1.31951 WP_000143859.1.31952 WP_000143859.1.31967 WP_000143859.1.31972 WP_000143859.1.32006 WP_000143859.1.32038 WP_000143859.1.32041 WP_000143859.1.32042 WP_000143859.1.32054 WP_000143859.1.3207 WP_000143859.1.32109 WP_000143859.1.32189 WP_000143859.1.32192 WP_000143859.1.32202 WP_000143859.1.32204 WP_000143859.1.32206 WP_000143859.1.32252 WP_000143859.1.32260 WP_000143859.1.32263 WP_000143859.1.32274 WP_000143859.1.32275 WP_000143859.1.32277 WP_000143859.1.32293 WP_000143859.1.32299 WP_000143859.1.32309 WP_000143859.1.32357 WP_000143859.1.32422 WP_000143859.1.32424 WP_000143859.1.32425 WP_000143859.1.32434 WP_000143859.1.32438 WP_000143859.1.32458 WP_000143859.1.32459 WP_000143859.1.32460 WP_000143859.1.32515 WP_000143859.1.32519 WP_000143859.1.32527 WP_000143859.1.32529 WP_000143859.1.32563 WP_000143859.1.32578 WP_000143859.1.32617 WP_000143859.1.32624 WP_000143859.1.32629 WP_000143859.1.32643 WP_000143859.1.32660 WP_000143859.1.3270 WP_000143859.1.32702 WP_000143859.1.32714 WP_000143859.1.32725 WP_000143859.1.32740 WP_000143859.1.32786 WP_000143859.1.32804 WP_000143859.1.32832 WP_000143859.1.32838 WP_000143859.1.32848 WP_000143859.1.32860 WP_000143859.1.32868 WP_000143859.1.32881 WP_000143859.1.32899 WP_000143859.1.3290 WP_000143859.1.32907 WP_000143859.1.32940 WP_000143859.1.32941 WP_000143859.1.3296 WP_000143859.1.32961 WP_000143859.1.32966 WP_000143859.1.32977 WP_000143859.1.32985 WP_000143859.1.33030 WP_000143859.1.33037 WP_000143859.1.3304 WP_000143859.1.3305 WP_000143859.1.33051 WP_000143859.1.33065 WP_000143859.1.33078 WP_000143859.1.33122 WP_000143859.1.33127 WP_000143859.1.33143 WP_000143859.1.3315 WP_000143859.1.33160 WP_000143859.1.33208 WP_000143859.1.33214 WP_000143859.1.33247 WP_000143859.1.33248 WP_000143859.1.33253 WP_000143859.1.33261 WP_000143859.1.33270 WP_000143859.1.33280 WP_000143859.1.33283 WP_000143859.1.333 WP_000143859.1.33313 WP_000143859.1.33339 WP_000143859.1.33382 WP_000143859.1.33409 WP_000143859.1.33486 WP_000143859.1.33490 WP_000143859.1.33492 WP_000143859.1.335 WP_000143859.1.33501 WP_000143859.1.33529 WP_000143859.1.33553 WP_000143859.1.3356 WP_000143859.1.33580 WP_000143859.1.33586 WP_000143859.1.33592 WP_000143859.1.33689 WP_000143859.1.3370 WP_000143859.1.33730 WP_000143859.1.33741 WP_000143859.1.33817 WP_000143859.1.33840 WP_000143859.1.33894 WP_000143859.1.3392 WP_000143859.1.33926 WP_000143859.1.3394 WP_000143859.1.3395 WP_000143859.1.33957 WP_000143859.1.3396 WP_000143859.1.33969 WP_000143859.1.34 WP_000143859.1.34001 WP_000143859.1.34043 WP_000143859.1.34059 WP_000143859.1.34075 WP_000143859.1.34081 WP_000143859.1.34091 WP_000143859.1.34107 WP_000143859.1.34118 WP_000143859.1.34179 WP_000143859.1.34185 WP_000143859.1.34211 WP_000143859.1.34214 WP_000143859.1.34234 WP_000143859.1.34257 WP_000143859.1.34279 WP_000143859.1.34284 WP_000143859.1.34304 WP_000143859.1.34319 WP_000143859.1.34376 WP_000143859.1.3438 WP_000143859.1.34382 WP_000143859.1.34417 WP_000143859.1.34431 WP_000143859.1.34453 WP_000143859.1.34454 WP_000143859.1.34484 WP_000143859.1.34496 WP_000143859.1.34517 WP_000143859.1.34530 WP_000143859.1.34610 WP_000143859.1.34614 WP_000143859.1.34647 WP_000143859.1.34659 WP_000143859.1.34665 WP_000143859.1.34667 WP_000143859.1.34694 WP_000143859.1.34704 WP_000143859.1.34711 WP_000143859.1.34745 WP_000143859.1.34751 WP_000143859.1.34808 WP_000143859.1.34817 WP_000143859.1.34820 WP_000143859.1.34824 WP_000143859.1.34834 WP_000143859.1.34856 WP_000143859.1.3489 WP_000143859.1.34932 WP_000143859.1.34962 WP_000143859.1.34975 WP_000143859.1.34977 WP_000143859.1.35001 WP_000143859.1.35035 WP_000143859.1.35040 WP_000143859.1.35045 WP_000143859.1.35074 WP_000143859.1.35075 WP_000143859.1.35125 WP_000143859.1.35129 WP_000143859.1.35175 WP_000143859.1.35184 WP_000143859.1.35193 WP_000143859.1.35240 WP_000143859.1.35274 WP_000143859.1.35294 WP_000143859.1.35298 WP_000143859.1.35321 WP_000143859.1.35404 WP_000143859.1.35408 WP_000143859.1.35429 WP_000143859.1.35460 WP_000143859.1.35463 WP_000143859.1.35494 WP_000143859.1.35503 WP_000143859.1.35509 WP_000143859.1.35532 WP_000143859.1.35560 WP_000143859.1.35563 WP_000143859.1.3557 WP_000143859.1.35570 WP_000143859.1.35590 WP_000143859.1.35594 WP_000143859.1.35624 WP_000143859.1.35628 WP_000143859.1.3570 WP_000143859.1.35712 WP_000143859.1.35713 WP_000143859.1.35736 WP_000143859.1.35777 WP_000143859.1.35791 WP_000143859.1.35795 WP_000143859.1.35868 WP_000143859.1.35870 WP_000143859.1.35887 WP_000143859.1.35892 WP_000143859.1.35916 WP_000143859.1.35936 WP_000143859.1.35938 WP_000143859.1.35940 WP_000143859.1.35961 WP_000143859.1.35966 WP_000143859.1.35993 WP_000143859.1.36000 WP_000143859.1.36003 WP_000143859.1.3601 WP_000143859.1.36017 WP_000143859.1.36034 WP_000143859.1.36036 WP_000143859.1.36037 WP_000143859.1.36063 WP_000143859.1.36069 WP_000143859.1.36157 WP_000143859.1.36172 WP_000143859.1.36236 WP_000143859.1.36286 WP_000143859.1.36291 WP_000143859.1.36298 WP_000143859.1.36308 WP_000143859.1.36323 WP_000143859.1.36343 WP_000143859.1.36409 WP_000143859.1.36425 WP_000143859.1.36445 WP_000143859.1.36460 WP_000143859.1.3649 WP_000143859.1.36495 WP_000143859.1.36512 WP_000143859.1.36526 WP_000143859.1.36542 WP_000143859.1.36547 WP_000143859.1.36564 WP_000143859.1.36567 WP_000143859.1.36579 WP_000143859.1.36584 WP_000143859.1.36592 WP_000143859.1.36609 WP_000143859.1.36617 WP_000143859.1.36618 WP_000143859.1.36643 WP_000143859.1.36663 WP_000143859.1.36685 WP_000143859.1.36690 WP_000143859.1.3670 WP_000143859.1.36701 WP_000143859.1.36705 WP_000143859.1.36721 WP_000143859.1.36725 WP_000143859.1.36751 WP_000143859.1.36765 WP_000143859.1.36779 WP_000143859.1.36798 WP_000143859.1.36802 WP_000143859.1.36821 WP_000143859.1.36853 WP_000143859.1.3688 WP_000143859.1.36889 WP_000143859.1.36918 WP_000143859.1.36931 WP_000143859.1.36950 WP_000143859.1.37014 WP_000143859.1.37028 WP_000143859.1.37029 WP_000143859.1.37063 WP_000143859.1.37073 WP_000143859.1.37111 WP_000143859.1.37112 WP_000143859.1.37114 WP_000143859.1.37133 WP_000143859.1.37176 WP_000143859.1.37190 WP_000143859.1.37191 WP_000143859.1.37199 WP_000143859.1.37200 WP_000143859.1.37256 WP_000143859.1.37258 WP_000143859.1.37267 WP_000143859.1.37293 WP_000143859.1.37297 WP_000143859.1.37303 WP_000143859.1.37320 WP_000143859.1.3734 WP_000143859.1.37370 WP_000143859.1.37376 WP_000143859.1.37405 WP_000143859.1.3744 WP_000143859.1.3748 WP_000143859.1.37498 WP_000143859.1.37504 WP_000143859.1.37513 WP_000143859.1.37558 WP_000143859.1.37584 WP_000143859.1.37590 WP_000143859.1.37593 WP_000143859.1.37600 WP_000143859.1.37610 WP_000143859.1.37613 WP_000143859.1.37618 WP_000143859.1.37659 WP_000143859.1.37666 WP_000143859.1.37675 WP_000143859.1.37687 WP_000143859.1.37691 WP_000143859.1.3771 WP_000143859.1.37719 WP_000143859.1.37761 WP_000143859.1.37775 WP_000143859.1.37777 WP_000143859.1.3778 WP_000143859.1.378 WP_000143859.1.379 WP_000143859.1.3790 WP_000143859.1.37911 WP_000143859.1.37941 WP_000143859.1.37965 WP_000143859.1.37968 WP_000143859.1.37978 WP_000143859.1.37985 WP_000143859.1.38001 WP_000143859.1.38037 WP_000143859.1.38047 WP_000143859.1.38061 WP_000143859.1.38064 WP_000143859.1.38108 WP_000143859.1.38125 WP_000143859.1.38145 WP_000143859.1.3816 WP_000143859.1.38199 WP_000143859.1.38207 WP_000143859.1.38261 WP_000143859.1.38266 WP_000143859.1.38273 WP_000143859.1.383 WP_000143859.1.38310 WP_000143859.1.3834 WP_000143859.1.38344 WP_000143859.1.38351 WP_000143859.1.3838 WP_000143859.1.38381 WP_000143859.1.38408 WP_000143859.1.38440 WP_000143859.1.3848 WP_000143859.1.38486 WP_000143859.1.38515 WP_000143859.1.38569 WP_000143859.1.38595 WP_000143859.1.3860 WP_000143859.1.38609 WP_000143859.1.38613 WP_000143859.1.38642 WP_000143859.1.38673 WP_000143859.1.3869 WP_000143859.1.38693 WP_000143859.1.38734 WP_000143859.1.38740 WP_000143859.1.38773 WP_000143859.1.38781 WP_000143859.1.38797 WP_000143859.1.38877 WP_000143859.1.38882 WP_000143859.1.38898 WP_000143859.1.3891 WP_000143859.1.38913 WP_000143859.1.38983 WP_000143859.1.38996 WP_000143859.1.39003 WP_000143859.1.39048 WP_000143859.1.39055 WP_000143859.1.39056 WP_000143859.1.39059 WP_000143859.1.39065 WP_000143859.1.3907 WP_000143859.1.39082 WP_000143859.1.39105 WP_000143859.1.39136 WP_000143859.1.3914 WP_000143859.1.39140 WP_000143859.1.39147 WP_000143859.1.39161 WP_000143859.1.39197 WP_000143859.1.39210 WP_000143859.1.39229 WP_000143859.1.39235 WP_000143859.1.39265 WP_000143859.1.3931 WP_000143859.1.39311 WP_000143859.1.39312 WP_000143859.1.39385 WP_000143859.1.39405 WP_000143859.1.39420 WP_000143859.1.39435 WP_000143859.1.39449 WP_000143859.1.39497 WP_000143859.1.39502 WP_000143859.1.39503 WP_000143859.1.39512 WP_000143859.1.39530 WP_000143859.1.39556 WP_000143859.1.39584 WP_000143859.1.39619 WP_000143859.1.39620 WP_000143859.1.39624 WP_000143859.1.39629 WP_000143859.1.39659 WP_000143859.1.39667 WP_000143859.1.39724 WP_000143859.1.39763 WP_000143859.1.39775 WP_000143859.1.39862 WP_000143859.1.39879 WP_000143859.1.39890 WP_000143859.1.39921 WP_000143859.1.39923 WP_000143859.1.39941 WP_000143859.1.39945 WP_000143859.1.39947 WP_000143859.1.40017 WP_000143859.1.40072 WP_000143859.1.40073 WP_000143859.1.40095 WP_000143859.1.40097 WP_000143859.1.401 WP_000143859.1.4011 WP_000143859.1.40111 WP_000143859.1.40160 WP_000143859.1.40167 WP_000143859.1.40170 WP_000143859.1.40205 WP_000143859.1.40208 WP_000143859.1.40240 WP_000143859.1.40257 WP_000143859.1.40279 WP_000143859.1.40292 WP_000143859.1.40305 WP_000143859.1.40307 WP_000143859.1.40311 WP_000143859.1.40341 WP_000143859.1.40361 WP_000143859.1.40380 WP_000143859.1.40395 WP_000143859.1.4042 WP_000143859.1.40465 WP_000143859.1.40467 WP_000143859.1.40492 WP_000143859.1.40493 WP_000143859.1.40496 WP_000143859.1.40508 WP_000143859.1.40517 WP_000143859.1.40577 WP_000143859.1.40583 WP_000143859.1.40605 WP_000143859.1.40622 WP_000143859.1.40695 WP_000143859.1.40698 WP_000143859.1.40710 WP_000143859.1.40745 WP_000143859.1.4075 WP_000143859.1.40750 WP_000143859.1.40763 WP_000143859.1.40771 WP_000143859.1.40788 WP_000143859.1.40849 WP_000143859.1.40854 WP_000143859.1.4087 WP_000143859.1.40877 WP_000143859.1.4088 WP_000143859.1.4089 WP_000143859.1.40924 WP_000143859.1.40930 WP_000143859.1.40932 WP_000143859.1.40946 WP_000143859.1.40973 WP_000143859.1.40996 WP_000143859.1.41004 WP_000143859.1.41017 WP_000143859.1.41018 WP_000143859.1.41048 WP_000143859.1.41050 WP_000143859.1.4106 WP_000143859.1.41070 WP_000143859.1.41074 WP_000143859.1.41075 WP_000143859.1.41086 WP_000143859.1.41091 WP_000143859.1.41097 WP_000143859.1.41116 WP_000143859.1.41128 WP_000143859.1.41132 WP_000143859.1.41226 WP_000143859.1.41251 WP_000143859.1.41258 WP_000143859.1.41277 WP_000143859.1.41279 WP_000143859.1.41299 WP_000143859.1.41305 WP_000143859.1.41310 WP_000143859.1.41321 WP_000143859.1.41333 WP_000143859.1.41335 WP_000143859.1.4136 WP_000143859.1.41415 WP_000143859.1.41427 WP_000143859.1.41440 WP_000143859.1.41459 WP_000143859.1.41498 WP_000143859.1.41516 WP_000143859.1.41519 WP_000143859.1.41524 WP_000143859.1.41528 WP_000143859.1.41554 WP_000143859.1.41572 WP_000143859.1.41591 WP_000143859.1.41610 WP_000143859.1.41631 WP_000143859.1.41658 WP_000143859.1.41659 WP_000143859.1.41662 WP_000143859.1.41690 WP_000143859.1.41708 WP_000143859.1.41716 WP_000143859.1.41735 WP_000143859.1.41746 WP_000143859.1.41761 WP_000143859.1.4178 WP_000143859.1.41799 WP_000143859.1.41824 WP_000143859.1.41825 WP_000143859.1.41836 WP_000143859.1.41859 WP_000143859.1.41862 WP_000143859.1.41882 WP_000143859.1.41894 WP_000143859.1.41897 WP_000143859.1.41911 WP_000143859.1.41919 WP_000143859.1.41929 WP_000143859.1.41931 WP_000143859.1.41938 WP_000143859.1.4194 WP_000143859.1.41949 WP_000143859.1.41978 WP_000143859.1.41979 WP_000143859.1.41985 WP_000143859.1.41994 WP_000143859.1.41998 WP_000143859.1.42009 WP_000143859.1.42069 WP_000143859.1.42081 WP_000143859.1.42090 WP_000143859.1.42104 WP_000143859.1.42111 WP_000143859.1.42136 WP_000143859.1.42156 WP_000143859.1.42187 WP_000143859.1.422 WP_000143859.1.42200 WP_000143859.1.42219 WP_000143859.1.4222 WP_000143859.1.42238 WP_000143859.1.42243 WP_000143859.1.42257 WP_000143859.1.42261 WP_000143859.1.42263 WP_000143859.1.42276 WP_000143859.1.42320 WP_000143859.1.42322 WP_000143859.1.42328 WP_000143859.1.42342 WP_000143859.1.42349 WP_000143859.1.42364 WP_000143859.1.42371 WP_000143859.1.42379 WP_000143859.1.42391 WP_000143859.1.42392 WP_000143859.1.42399 WP_000143859.1.42404 WP_000143859.1.42422 WP_000143859.1.42444 WP_000143859.1.42489 WP_000143859.1.42491 WP_000143859.1.42539 WP_000143859.1.4257 WP_000143859.1.42603 WP_000143859.1.42650 WP_000143859.1.42666 WP_000143859.1.4267 WP_000143859.1.42676 WP_000143859.1.42685 WP_000143859.1.42701 WP_000143859.1.42734 WP_000143859.1.4276 WP_000143859.1.42797 WP_000143859.1.42805 WP_000143859.1.42815 WP_000143859.1.42829 WP_000143859.1.42859 WP_000143859.1.42864 WP_000143859.1.4288 WP_000143859.1.42887 WP_000143859.1.42932 WP_000143859.1.42957 WP_000143859.1.4298 WP_000143859.1.42981 WP_000143859.1.43008 WP_000143859.1.43016 WP_000143859.1.43018 WP_000143859.1.43019 WP_000143859.1.43041 WP_000143859.1.43065 WP_000143859.1.43068 WP_000143859.1.43069 WP_000143859.1.43086 WP_000143859.1.43089 WP_000143859.1.43126 WP_000143859.1.43128 WP_000143859.1.43141 WP_000143859.1.43157 WP_000143859.1.43160 WP_000143859.1.43161 WP_000143859.1.43190 WP_000143859.1.43198 WP_000143859.1.43201 WP_000143859.1.43244 WP_000143859.1.4326 WP_000143859.1.43272 WP_000143859.1.43290 WP_000143859.1.43292 WP_000143859.1.43299 WP_000143859.1.43307 WP_000143859.1.43312 WP_000143859.1.4332 WP_000143859.1.43334 WP_000143859.1.43339 WP_000143859.1.43351 WP_000143859.1.43371 WP_000143859.1.43437 WP_000143859.1.4344 WP_000143859.1.43476 WP_000143859.1.43513 WP_000143859.1.43522 WP_000143859.1.43535 WP_000143859.1.43613 WP_000143859.1.43633 WP_000143859.1.43637 WP_000143859.1.43651 WP_000143859.1.43668 WP_000143859.1.43685 WP_000143859.1.43711 WP_000143859.1.43722 WP_000143859.1.4373 WP_000143859.1.43763 WP_000143859.1.43778 WP_000143859.1.43782 WP_000143859.1.43785 WP_000143859.1.43801 WP_000143859.1.43812 WP_000143859.1.43864 WP_000143859.1.43873 WP_000143859.1.43875 WP_000143859.1.43878 WP_000143859.1.43888 WP_000143859.1.43919 WP_000143859.1.43951 WP_000143859.1.43954 WP_000143859.1.43974 WP_000143859.1.44005 WP_000143859.1.44010 WP_000143859.1.44043 WP_000143859.1.44049 WP_000143859.1.4405 WP_000143859.1.44063 WP_000143859.1.44099 WP_000143859.1.44101 WP_000143859.1.44113 WP_000143859.1.44121 WP_000143859.1.44160 WP_000143859.1.44180 WP_000143859.1.44191 WP_000143859.1.44196 WP_000143859.1.4423 WP_000143859.1.44248 WP_000143859.1.44250 WP_000143859.1.44262 WP_000143859.1.44268 WP_000143859.1.4427 WP_000143859.1.44291 WP_000143859.1.44296 WP_000143859.1.44300 WP_000143859.1.44310 WP_000143859.1.44337 WP_000143859.1.44343 WP_000143859.1.44351 WP_000143859.1.44360 WP_000143859.1.44380 WP_000143859.1.44386 WP_000143859.1.4440 WP_000143859.1.44416 WP_000143859.1.44431 WP_000143859.1.44433 WP_000143859.1.44437 WP_000143859.1.44438 WP_000143859.1.44440 WP_000143859.1.44474 WP_000143859.1.44479 WP_000143859.1.44546 WP_000143859.1.44549 WP_000143859.1.44578 WP_000143859.1.44593 WP_000143859.1.44607 WP_000143859.1.44640 WP_000143859.1.4467 WP_000143859.1.4468 WP_000143859.1.44702 WP_000143859.1.44705 WP_000143859.1.44747 WP_000143859.1.44762 WP_000143859.1.44795 WP_000143859.1.44815 WP_000143859.1.44828 WP_000143859.1.44831 WP_000143859.1.4485 WP_000143859.1.44877 WP_000143859.1.44879 WP_000143859.1.44917 WP_000143859.1.44927 WP_000143859.1.44933 WP_000143859.1.44966 WP_000143859.1.44971 WP_000143859.1.44978 WP_000143859.1.44997 WP_000143859.1.4500 WP_000143859.1.4501 WP_000143859.1.45027 WP_000143859.1.45038 WP_000143859.1.45045 WP_000143859.1.45067 WP_000143859.1.45072 WP_000143859.1.45074 WP_000143859.1.45079 WP_000143859.1.45093 WP_000143859.1.45098 WP_000143859.1.45123 WP_000143859.1.45136 WP_000143859.1.45145 WP_000143859.1.45173 WP_000143859.1.45177 WP_000143859.1.45184 WP_000143859.1.45241 WP_000143859.1.45259 WP_000143859.1.45268 WP_000143859.1.4531 WP_000143859.1.45322 WP_000143859.1.45344 WP_000143859.1.45349 WP_000143859.1.45365 WP_000143859.1.45402 WP_000143859.1.45432 WP_000143859.1.45434 WP_000143859.1.45435 WP_000143859.1.45462 WP_000143859.1.45468 WP_000143859.1.45522 WP_000143859.1.45523 WP_000143859.1.45535 WP_000143859.1.45549 WP_000143859.1.45550 WP_000143859.1.45582 WP_000143859.1.45583 WP_000143859.1.45585 WP_000143859.1.45596 WP_000143859.1.45622 WP_000143859.1.45648 WP_000143859.1.45660 WP_000143859.1.45690 WP_000143859.1.45797 WP_000143859.1.458 WP_000143859.1.45829 WP_000143859.1.45844 WP_000143859.1.45848 WP_000143859.1.45871 WP_000143859.1.45906 WP_000143859.1.45984 WP_000143859.1.46011 WP_000143859.1.46030 WP_000143859.1.46069 WP_000143859.1.46077 WP_000143859.1.46091 WP_000143859.1.46124 WP_000143859.1.46169 WP_000143859.1.46173 WP_000143859.1.46174 WP_000143859.1.46187 WP_000143859.1.46203 WP_000143859.1.46215 WP_000143859.1.46225 WP_000143859.1.46232 WP_000143859.1.46241 WP_000143859.1.46243 WP_000143859.1.46278 WP_000143859.1.46299 WP_000143859.1.46303 WP_000143859.1.46307 WP_000143859.1.46322 WP_000143859.1.46355 WP_000143859.1.464 WP_000143859.1.46454 WP_000143859.1.46461 WP_000143859.1.46504 WP_000143859.1.46505 WP_000143859.1.46551 WP_000143859.1.46559 WP_000143859.1.46574 WP_000143859.1.46578 WP_000143859.1.46595 WP_000143859.1.46620 WP_000143859.1.46666 WP_000143859.1.46675 WP_000143859.1.46693 WP_000143859.1.46701 WP_000143859.1.46726 WP_000143859.1.46730 WP_000143859.1.4674 WP_000143859.1.46749 WP_000143859.1.46781 WP_000143859.1.46804 WP_000143859.1.46816 WP_000143859.1.46842 WP_000143859.1.4686 WP_000143859.1.4690 WP_000143859.1.46920 WP_000143859.1.46930 WP_000143859.1.46945 WP_000143859.1.46961 WP_000143859.1.46967 WP_000143859.1.46976 WP_000143859.1.47008 WP_000143859.1.47036 WP_000143859.1.47037 WP_000143859.1.47042 WP_000143859.1.47057 WP_000143859.1.47059 WP_000143859.1.47067 WP_000143859.1.47085 WP_000143859.1.47123 WP_000143859.1.47214 WP_000143859.1.47215 WP_000143859.1.47245 WP_000143859.1.47257 WP_000143859.1.47389 WP_000143859.1.47429 WP_000143859.1.47442 WP_000143859.1.47448 WP_000143859.1.4747 WP_000143859.1.47472 WP_000143859.1.47478 WP_000143859.1.47482 WP_000143859.1.47492 WP_000143859.1.47507 WP_000143859.1.47523 WP_000143859.1.47531 WP_000143859.1.47532 WP_000143859.1.47567 WP_000143859.1.47576 WP_000143859.1.47579 WP_000143859.1.4758 WP_000143859.1.47605 WP_000143859.1.47621 WP_000143859.1.47630 WP_000143859.1.47714 WP_000143859.1.4774 WP_000143859.1.47756 WP_000143859.1.47799 WP_000143859.1.4781 WP_000143859.1.47814 WP_000143859.1.47829 WP_000143859.1.47850 WP_000143859.1.47886 WP_000143859.1.47898 WP_000143859.1.47911 WP_000143859.1.47928 WP_000143859.1.4795 WP_000143859.1.47988 WP_000143859.1.47992 WP_000143859.1.48019 WP_000143859.1.48100 WP_000143859.1.48114 WP_000143859.1.48124 WP_000143859.1.48139 WP_000143859.1.48190 WP_000143859.1.48209 WP_000143859.1.48215 WP_000143859.1.48218 WP_000143859.1.48242 WP_000143859.1.48247 WP_000143859.1.48253 WP_000143859.1.48262 WP_000143859.1.48292 WP_000143859.1.483 WP_000143859.1.48324 WP_000143859.1.48367 WP_000143859.1.48377 WP_000143859.1.4839 WP_000143859.1.48426 WP_000143859.1.48430 WP_000143859.1.48436 WP_000143859.1.48455 WP_000143859.1.48493 WP_000143859.1.4853 WP_000143859.1.48570 WP_000143859.1.48586 WP_000143859.1.4859 WP_000143859.1.48591 WP_000143859.1.48610 WP_000143859.1.48631 WP_000143859.1.48647 WP_000143859.1.48651 WP_000143859.1.48663 WP_000143859.1.48734 WP_000143859.1.48755 WP_000143859.1.48756 WP_000143859.1.48774 WP_000143859.1.48778 WP_000143859.1.48788 WP_000143859.1.48797 WP_000143859.1.48849 WP_000143859.1.4885 WP_000143859.1.48894 WP_000143859.1.48919 WP_000143859.1.48955 WP_000143859.1.48963 WP_000143859.1.48973 WP_000143859.1.48985 WP_000143859.1.49004 WP_000143859.1.49005 WP_000143859.1.49084 WP_000143859.1.49102 WP_000143859.1.49106 WP_000143859.1.49113 WP_000143859.1.49117 WP_000143859.1.49121 WP_000143859.1.4914 WP_000143859.1.49140 WP_000143859.1.49153 WP_000143859.1.49155 WP_000143859.1.49162 WP_000143859.1.49166 WP_000143859.1.49175 WP_000143859.1.49204 WP_000143859.1.49226 WP_000143859.1.49233 WP_000143859.1.49239 WP_000143859.1.49256 WP_000143859.1.49262 WP_000143859.1.49290 WP_000143859.1.49311 WP_000143859.1.49334 WP_000143859.1.49340 WP_000143859.1.49355 WP_000143859.1.49366 WP_000143859.1.49375 WP_000143859.1.49429 WP_000143859.1.49434 WP_000143859.1.49450 WP_000143859.1.49472 WP_000143859.1.49490 WP_000143859.1.495 WP_000143859.1.49515 WP_000143859.1.49545 WP_000143859.1.49572 WP_000143859.1.49574 WP_000143859.1.49647 WP_000143859.1.49650 WP_000143859.1.49703 WP_000143859.1.49769 WP_000143859.1.49770 WP_000143859.1.49778 WP_000143859.1.4979 WP_000143859.1.49803 WP_000143859.1.49805 WP_000143859.1.49827 WP_000143859.1.49846 WP_000143859.1.49848 WP_000143859.1.4991 WP_000143859.1.49929 WP_000143859.1.49931 WP_000143859.1.49947 WP_000143859.1.49959 WP_000143859.1.49997 WP_000143859.1.50007 WP_000143859.1.50014 WP_000143859.1.50030 WP_000143859.1.50043 WP_000143859.1.50080 WP_000143859.1.5009 WP_000143859.1.50103 WP_000143859.1.50128 WP_000143859.1.50158 WP_000143859.1.50161 WP_000143859.1.50198 WP_000143859.1.50211 WP_000143859.1.50239 WP_000143859.1.50247 WP_000143859.1.50285 WP_000143859.1.50308 WP_000143859.1.50309 WP_000143859.1.50332 WP_000143859.1.50349 WP_000143859.1.50374 WP_000143859.1.50376 WP_000143859.1.50386 WP_000143859.1.50387 WP_000143859.1.50389 WP_000143859.1.50404 WP_000143859.1.50406 WP_000143859.1.50413 WP_000143859.1.50449 WP_000143859.1.50468 WP_000143859.1.50480 WP_000143859.1.5051 WP_000143859.1.50566 WP_000143859.1.50570 WP_000143859.1.50593 WP_000143859.1.50626 WP_000143859.1.50652 WP_000143859.1.50676 WP_000143859.1.50684 WP_000143859.1.50726 WP_000143859.1.50769 WP_000143859.1.50771 WP_000143859.1.50774 WP_000143859.1.50782 WP_000143859.1.50800 WP_000143859.1.50804 WP_000143859.1.50808 WP_000143859.1.50811 WP_000143859.1.50875 WP_000143859.1.5088 WP_000143859.1.50882 WP_000143859.1.50885 WP_000143859.1.509 WP_000143859.1.50908 WP_000143859.1.50918 WP_000143859.1.50929 WP_000143859.1.50941 WP_000143859.1.50954 WP_000143859.1.50960 WP_000143859.1.50970 WP_000143859.1.50999 WP_000143859.1.51014 WP_000143859.1.51022 WP_000143859.1.51025 WP_000143859.1.51040 WP_000143859.1.51048 WP_000143859.1.51066 WP_000143859.1.51100 WP_000143859.1.51134 WP_000143859.1.51162 WP_000143859.1.51179 WP_000143859.1.51182 WP_000143859.1.51186 WP_000143859.1.51224 WP_000143859.1.51227 WP_000143859.1.5127 WP_000143859.1.51305 WP_000143859.1.51315 WP_000143859.1.51338 WP_000143859.1.51356 WP_000143859.1.5136 WP_000143859.1.51412 WP_000143859.1.51414 WP_000143859.1.51451 WP_000143859.1.51464 WP_000143859.1.51474 WP_000143859.1.51487 WP_000143859.1.51488 WP_000143859.1.51502 WP_000143859.1.51506 WP_000143859.1.51519 WP_000143859.1.51555 WP_000143859.1.51594 WP_000143859.1.51598 WP_000143859.1.51611 WP_000143859.1.51634 WP_000143859.1.51642 WP_000143859.1.51644 WP_000143859.1.51649 WP_000143859.1.51686 WP_000143859.1.51700 WP_000143859.1.51724 WP_000143859.1.51734 WP_000143859.1.51756 WP_000143859.1.51810 WP_000143859.1.51831 WP_000143859.1.51838 WP_000143859.1.51841 WP_000143859.1.51863 WP_000143859.1.51868 WP_000143859.1.51900 WP_000143859.1.51911 WP_000143859.1.51930 WP_000143859.1.51932 WP_000143859.1.51935 WP_000143859.1.51989 WP_000143859.1.51994 WP_000143859.1.520 WP_000143859.1.52057 WP_000143859.1.52114 WP_000143859.1.52121 WP_000143859.1.52123 WP_000143859.1.52129 WP_000143859.1.52148 WP_000143859.1.5216 WP_000143859.1.52170 WP_000143859.1.52191 WP_000143859.1.52202 WP_000143859.1.52209 WP_000143859.1.52255 WP_000143859.1.52301 WP_000143859.1.52336 WP_000143859.1.52339 WP_000143859.1.52346 WP_000143859.1.52353 WP_000143859.1.52361 WP_000143859.1.52438 WP_000143859.1.52469 WP_000143859.1.52527 WP_000143859.1.52571 WP_000143859.1.52582 WP_000143859.1.52586 WP_000143859.1.526 WP_000143859.1.52608 WP_000143859.1.52647 WP_000143859.1.52653 WP_000143859.1.52656 WP_000143859.1.52675 WP_000143859.1.52692 WP_000143859.1.52742 WP_000143859.1.52743 WP_000143859.1.52748 WP_000143859.1.52773 WP_000143859.1.52795 WP_000143859.1.52807 WP_000143859.1.52824 WP_000143859.1.52833 WP_000143859.1.52857 WP_000143859.1.52866 WP_000143859.1.52887 WP_000143859.1.52898 WP_000143859.1.52915 WP_000143859.1.52924 WP_000143859.1.52949 WP_000143859.1.5301 WP_000143859.1.53092 WP_000143859.1.53100 WP_000143859.1.53107 WP_000143859.1.53119 WP_000143859.1.5313 WP_000143859.1.53141 WP_000143859.1.53151 WP_000143859.1.53154 WP_000143859.1.53158 WP_000143859.1.53159 WP_000143859.1.5316 WP_000143859.1.53179 WP_000143859.1.53190 WP_000143859.1.53198 WP_000143859.1.53206 WP_000143859.1.53210 WP_000143859.1.53233 WP_000143859.1.53234 WP_000143859.1.53272 WP_000143859.1.53274 WP_000143859.1.53286 WP_000143859.1.53307 WP_000143859.1.53316 WP_000143859.1.53321 WP_000143859.1.53328 WP_000143859.1.5333 WP_000143859.1.53368 WP_000143859.1.53375 WP_000143859.1.53385 WP_000143859.1.53406 WP_000143859.1.53436 WP_000143859.1.53450 WP_000143859.1.53454 WP_000143859.1.53466 WP_000143859.1.5349 WP_000143859.1.53529 WP_000143859.1.53540 WP_000143859.1.53543 WP_000143859.1.53555 WP_000143859.1.53559 WP_000143859.1.5356 WP_000143859.1.53567 WP_000143859.1.53571 WP_000143859.1.5358 WP_000143859.1.53664 WP_000143859.1.53675 WP_000143859.1.53688 WP_000143859.1.53692 WP_000143859.1.53694 WP_000143859.1.53723 WP_000143859.1.5374 WP_000143859.1.53750 WP_000143859.1.53757 WP_000143859.1.53778 WP_000143859.1.53781 WP_000143859.1.53800 WP_000143859.1.53812 WP_000143859.1.53815 WP_000143859.1.53839 WP_000143859.1.53892 WP_000143859.1.53896 WP_000143859.1.53898 WP_000143859.1.53902 WP_000143859.1.53905 WP_000143859.1.53935 WP_000143859.1.53958 WP_000143859.1.53961 WP_000143859.1.53981 WP_000143859.1.53984 WP_000143859.1.54033 WP_000143859.1.54061 WP_000143859.1.54075 WP_000143859.1.54082 WP_000143859.1.54132 WP_000143859.1.54136 WP_000143859.1.54159 WP_000143859.1.54170 WP_000143859.1.54175 WP_000143859.1.54196 WP_000143859.1.542 WP_000143859.1.54203 WP_000143859.1.54209 WP_000143859.1.54259 WP_000143859.1.54271 WP_000143859.1.54273 WP_000143859.1.54274 WP_000143859.1.54283 WP_000143859.1.5430 WP_000143859.1.54319 WP_000143859.1.54333 WP_000143859.1.54364 WP_000143859.1.54366 WP_000143859.1.54371 WP_000143859.1.54400 WP_000143859.1.54431 WP_000143859.1.54442 WP_000143859.1.54482 WP_000143859.1.54500 WP_000143859.1.54526 WP_000143859.1.54558 WP_000143859.1.54569 WP_000143859.1.54589 WP_000143859.1.54607 WP_000143859.1.54615 WP_000143859.1.54644 WP_000143859.1.54662 WP_000143859.1.54667 WP_000143859.1.54678 WP_000143859.1.54681 WP_000143859.1.54722 WP_000143859.1.54748 WP_000143859.1.54749 WP_000143859.1.54764 WP_000143859.1.5481 WP_000143859.1.54822 WP_000143859.1.54833 WP_000143859.1.54865 WP_000143859.1.54877 WP_000143859.1.54935 WP_000143859.1.54936 WP_000143859.1.54979 WP_000143859.1.54984 WP_000143859.1.55008 WP_000143859.1.55010 WP_000143859.1.55034 WP_000143859.1.55152 WP_000143859.1.55156 WP_000143859.1.55163 WP_000143859.1.55165 WP_000143859.1.5517 WP_000143859.1.55215 WP_000143859.1.55224 WP_000143859.1.5523 WP_000143859.1.5525 WP_000143859.1.55285 WP_000143859.1.55290 WP_000143859.1.55310 WP_000143859.1.55317 WP_000143859.1.55325 WP_000143859.1.55379 WP_000143859.1.5539 WP_000143859.1.55418 WP_000143859.1.55430 WP_000143859.1.55461 WP_000143859.1.55468 WP_000143859.1.55475 WP_000143859.1.55477 WP_000143859.1.55496 WP_000143859.1.55506 WP_000143859.1.5555 WP_000143859.1.55554 WP_000143859.1.55559 WP_000143859.1.5560 WP_000143859.1.55604 WP_000143859.1.55614 WP_000143859.1.55623 WP_000143859.1.55639 WP_000143859.1.55640 WP_000143859.1.55647 WP_000143859.1.55680 WP_000143859.1.55699 WP_000143859.1.55706 WP_000143859.1.55718 WP_000143859.1.5572 WP_000143859.1.55725 WP_000143859.1.55743 WP_000143859.1.55768 WP_000143859.1.5577 WP_000143859.1.55780 WP_000143859.1.55782 WP_000143859.1.55796 WP_000143859.1.55923 WP_000143859.1.55948 WP_000143859.1.55967 WP_000143859.1.55973 WP_000143859.1.55993 WP_000143859.1.56002 WP_000143859.1.56012 WP_000143859.1.56059 WP_000143859.1.56069 WP_000143859.1.56097 WP_000143859.1.56105 WP_000143859.1.56130 WP_000143859.1.56144 WP_000143859.1.56172 WP_000143859.1.5621 WP_000143859.1.56222 WP_000143859.1.56226 WP_000143859.1.56238 WP_000143859.1.56244 WP_000143859.1.56247 WP_000143859.1.56263 WP_000143859.1.56286 WP_000143859.1.56303 WP_000143859.1.56304 WP_000143859.1.56305 WP_000143859.1.56311 WP_000143859.1.56354 WP_000143859.1.56370 WP_000143859.1.56385 WP_000143859.1.56393 WP_000143859.1.56414 WP_000143859.1.56419 WP_000143859.1.56420 WP_000143859.1.56423 WP_000143859.1.56438 WP_000143859.1.56468 WP_000143859.1.56512 WP_000143859.1.56514 WP_000143859.1.56535 WP_000143859.1.56559 WP_000143859.1.56560 WP_000143859.1.56597 WP_000143859.1.56601 WP_000143859.1.56614 WP_000143859.1.56615 WP_000143859.1.56640 WP_000143859.1.56642 WP_000143859.1.56660 WP_000143859.1.56671 WP_000143859.1.5668 WP_000143859.1.56682 WP_000143859.1.56724 WP_000143859.1.56825 WP_000143859.1.56851 WP_000143859.1.56853 WP_000143859.1.56861 WP_000143859.1.56875 WP_000143859.1.56877 WP_000143859.1.56887 WP_000143859.1.56889 WP_000143859.1.56893 WP_000143859.1.56898 WP_000143859.1.56981 WP_000143859.1.57026 WP_000143859.1.57039 WP_000143859.1.57056 WP_000143859.1.57101 WP_000143859.1.5711 WP_000143859.1.57125 WP_000143859.1.57137 WP_000143859.1.57147 WP_000143859.1.57149 WP_000143859.1.57168 WP_000143859.1.57179 WP_000143859.1.57186 WP_000143859.1.57187 WP_000143859.1.57232 WP_000143859.1.57233 WP_000143859.1.57296 WP_000143859.1.57307 WP_000143859.1.57342 WP_000143859.1.57356 WP_000143859.1.57357 WP_000143859.1.57362 WP_000143859.1.57377 WP_000143859.1.57418 WP_000143859.1.57433 WP_000143859.1.57515 WP_000143859.1.57529 WP_000143859.1.5753 WP_000143859.1.57559 WP_000143859.1.57576 WP_000143859.1.57601 WP_000143859.1.57607 WP_000143859.1.57631 WP_000143859.1.57641 WP_000143859.1.57684 WP_000143859.1.57699 WP_000143859.1.57710 WP_000143859.1.57735 WP_000143859.1.5774 WP_000143859.1.57763 WP_000143859.1.57778 WP_000143859.1.57785 WP_000143859.1.57800 WP_000143859.1.5781 WP_000143859.1.57835 WP_000143859.1.57862 WP_000143859.1.57873 WP_000143859.1.57890 WP_000143859.1.57891 WP_000143859.1.57893 WP_000143859.1.57965 WP_000143859.1.57972 WP_000143859.1.57978 WP_000143859.1.58008 WP_000143859.1.5801 WP_000143859.1.58040 WP_000143859.1.58041 WP_000143859.1.58044 WP_000143859.1.58081 WP_000143859.1.5809 WP_000143859.1.58090 WP_000143859.1.58132 WP_000143859.1.58173 WP_000143859.1.58191 WP_000143859.1.58194 WP_000143859.1.58249 WP_000143859.1.58251 WP_000143859.1.58252 WP_000143859.1.58261 WP_000143859.1.58274 WP_000143859.1.5828 WP_000143859.1.58282 WP_000143859.1.58290 WP_000143859.1.58301 WP_000143859.1.58324 WP_000143859.1.58326 WP_000143859.1.58334 WP_000143859.1.58357 WP_000143859.1.58358 WP_000143859.1.5836 WP_000143859.1.58372 WP_000143859.1.58407 WP_000143859.1.58442 WP_000143859.1.58451 WP_000143859.1.58485 WP_000143859.1.58486 WP_000143859.1.58489 WP_000143859.1.58537 WP_000143859.1.5854 WP_000143859.1.58548 WP_000143859.1.58564 WP_000143859.1.58568 WP_000143859.1.5858 WP_000143859.1.58583 WP_000143859.1.58633 WP_000143859.1.58652 WP_000143859.1.58662 WP_000143859.1.58663 WP_000143859.1.58669 WP_000143859.1.58675 WP_000143859.1.587 WP_000143859.1.58724 WP_000143859.1.58729 WP_000143859.1.58745 WP_000143859.1.5875 WP_000143859.1.5878 WP_000143859.1.58796 WP_000143859.1.58803 WP_000143859.1.58807 WP_000143859.1.58831 WP_000143859.1.58834 WP_000143859.1.58836 WP_000143859.1.58847 WP_000143859.1.5886 WP_000143859.1.58861 WP_000143859.1.58883 WP_000143859.1.58884 WP_000143859.1.58898 WP_000143859.1.58926 WP_000143859.1.58932 WP_000143859.1.58949 WP_000143859.1.58963 WP_000143859.1.58970 WP_000143859.1.58974 WP_000143859.1.59020 WP_000143859.1.59043 WP_000143859.1.59056 WP_000143859.1.59061 WP_000143859.1.59064 WP_000143859.1.59084 WP_000143859.1.59094 WP_000143859.1.59125 WP_000143859.1.59142 WP_000143859.1.59148 WP_000143859.1.59163 WP_000143859.1.59224 WP_000143859.1.59282 WP_000143859.1.59299 WP_000143859.1.59313 WP_000143859.1.59321 WP_000143859.1.59336 WP_000143859.1.59375 WP_000143859.1.59381 WP_000143859.1.59420 WP_000143859.1.59427 WP_000143859.1.59458 WP_000143859.1.59486 WP_000143859.1.5949 WP_000143859.1.59490 WP_000143859.1.59501 WP_000143859.1.59508 WP_000143859.1.59510 WP_000143859.1.59521 WP_000143859.1.5953 WP_000143859.1.59538 WP_000143859.1.59548 WP_000143859.1.59562 WP_000143859.1.59587 WP_000143859.1.59604 WP_000143859.1.59641 WP_000143859.1.59646 WP_000143859.1.59684 WP_000143859.1.5969 WP_000143859.1.59694 WP_000143859.1.59710 WP_000143859.1.59751 WP_000143859.1.59771 WP_000143859.1.5979 WP_000143859.1.59827 WP_000143859.1.59829 WP_000143859.1.59830 WP_000143859.1.59847 WP_000143859.1.59848 WP_000143859.1.59863 WP_000143859.1.59928 WP_000143859.1.59953 WP_000143859.1.59969 WP_000143859.1.59994 WP_000143859.1.60004 WP_000143859.1.60008 WP_000143859.1.60021 WP_000143859.1.60045 WP_000143859.1.60052 WP_000143859.1.60069 WP_000143859.1.60076 WP_000143859.1.60114 WP_000143859.1.60126 WP_000143859.1.60137 WP_000143859.1.60140 WP_000143859.1.60154 WP_000143859.1.60155 WP_000143859.1.60168 WP_000143859.1.60192 WP_000143859.1.60199 WP_000143859.1.60212 WP_000143859.1.60213 WP_000143859.1.60226 WP_000143859.1.60231 WP_000143859.1.60253 WP_000143859.1.60285 WP_000143859.1.60320 WP_000143859.1.60322 WP_000143859.1.60324 WP_000143859.1.6033 WP_000143859.1.60330 WP_000143859.1.60356 WP_000143859.1.60379 WP_000143859.1.6038 WP_000143859.1.60380 WP_000143859.1.6041 WP_000143859.1.60424 WP_000143859.1.60425 WP_000143859.1.60464 WP_000143859.1.60481 WP_000143859.1.605 WP_000143859.1.60507 WP_000143859.1.60545 WP_000143859.1.60560 WP_000143859.1.60561 WP_000143859.1.6058 WP_000143859.1.60584 WP_000143859.1.6060 WP_000143859.1.60643 WP_000143859.1.60676 WP_000143859.1.60708 WP_000143859.1.60713 WP_000143859.1.60725 WP_000143859.1.60772 WP_000143859.1.60783 WP_000143859.1.60792 WP_000143859.1.60794 WP_000143859.1.608 WP_000143859.1.60807 WP_000143859.1.60838 WP_000143859.1.60851 WP_000143859.1.60855 WP_000143859.1.60857 WP_000143859.1.60866 WP_000143859.1.60874 WP_000143859.1.60882 WP_000143859.1.60889 WP_000143859.1.60897 WP_000143859.1.6090 WP_000143859.1.60919 WP_000143859.1.60926 WP_000143859.1.60941 WP_000143859.1.60950 WP_000143859.1.60988 WP_000143859.1.60990 WP_000143859.1.6104 WP_000143859.1.61044 WP_000143859.1.61045 WP_000143859.1.61076 WP_000143859.1.61078 WP_000143859.1.61087 WP_000143859.1.61123 WP_000143859.1.6114 WP_000143859.1.61146 WP_000143859.1.61147 WP_000143859.1.61168 WP_000143859.1.61184 WP_000143859.1.61200 WP_000143859.1.61210 WP_000143859.1.61232 WP_000143859.1.61233 WP_000143859.1.6129 WP_000143859.1.61296 WP_000143859.1.61345 WP_000143859.1.61357 WP_000143859.1.61381 WP_000143859.1.61417 WP_000143859.1.61434 WP_000143859.1.61497 WP_000143859.1.61501 WP_000143859.1.61511 WP_000143859.1.61539 WP_000143859.1.61542 WP_000143859.1.61553 WP_000143859.1.61574 WP_000143859.1.61594 WP_000143859.1.61595 WP_000143859.1.61609 WP_000143859.1.6164 WP_000143859.1.61649 WP_000143859.1.61652 WP_000143859.1.61667 WP_000143859.1.61671 WP_000143859.1.61697 WP_000143859.1.61712 WP_000143859.1.61714 WP_000143859.1.61730 WP_000143859.1.61737 WP_000143859.1.61809 WP_000143859.1.61857 WP_000143859.1.61877 WP_000143859.1.6190 WP_000143859.1.61908 WP_000143859.1.61920 WP_000143859.1.61924 WP_000143859.1.61952 WP_000143859.1.62007 WP_000143859.1.62020 WP_000143859.1.62025 WP_000143859.1.6209 WP_000143859.1.6210 WP_000143859.1.62124 WP_000143859.1.62142 WP_000143859.1.62158 WP_000143859.1.62184 WP_000143859.1.62199 WP_000143859.1.62201 WP_000143859.1.62204 WP_000143859.1.62210 WP_000143859.1.62219 WP_000143859.1.62223 WP_000143859.1.62241 WP_000143859.1.62257 WP_000143859.1.62302 WP_000143859.1.62304 WP_000143859.1.62310 WP_000143859.1.62314 WP_000143859.1.62323 WP_000143859.1.62333 WP_000143859.1.62338 WP_000143859.1.62344 WP_000143859.1.62361 WP_000143859.1.62364 WP_000143859.1.62374 WP_000143859.1.62380 WP_000143859.1.62403 WP_000143859.1.62411 WP_000143859.1.62412 WP_000143859.1.62436 WP_000143859.1.62475 WP_000143859.1.62486 WP_000143859.1.62504 WP_000143859.1.6253 WP_000143859.1.62536 WP_000143859.1.62570 WP_000143859.1.62640 WP_000143859.1.62677 WP_000143859.1.62686 WP_000143859.1.627 WP_000143859.1.62725 WP_000143859.1.62745 WP_000143859.1.62751 WP_000143859.1.62757 WP_000143859.1.62798 WP_000143859.1.62825 WP_000143859.1.62828 WP_000143859.1.62853 WP_000143859.1.62903 WP_000143859.1.62910 WP_000143859.1.62913 WP_000143859.1.6292 WP_000143859.1.62932 WP_000143859.1.62955 WP_000143859.1.62960 WP_000143859.1.62983 WP_000143859.1.62988 WP_000143859.1.63016 WP_000143859.1.63025 WP_000143859.1.63043 WP_000143859.1.63045 WP_000143859.1.63063 WP_000143859.1.63069 WP_000143859.1.63087 WP_000143859.1.63102 WP_000143859.1.63118 WP_000143859.1.63129 WP_000143859.1.63135 WP_000143859.1.63150 WP_000143859.1.63155 WP_000143859.1.63169 WP_000143859.1.63181 WP_000143859.1.63203 WP_000143859.1.63234 WP_000143859.1.63250 WP_000143859.1.63256 WP_000143859.1.63290 WP_000143859.1.63297 WP_000143859.1.63358 WP_000143859.1.63382 WP_000143859.1.63422 WP_000143859.1.63432 WP_000143859.1.63448 WP_000143859.1.63461 WP_000143859.1.63479 WP_000143859.1.63497 WP_000143859.1.63499 WP_000143859.1.63509 WP_000143859.1.63513 WP_000143859.1.63514 WP_000143859.1.63529 WP_000143859.1.63532 WP_000143859.1.63577 WP_000143859.1.63583 WP_000143859.1.63592 WP_000143859.1.63603 WP_000143859.1.63663 WP_000143859.1.63664 WP_000143859.1.6367 WP_000143859.1.63677 WP_000143859.1.6370 WP_000143859.1.63718 WP_000143859.1.63736 WP_000143859.1.63748 WP_000143859.1.6375 WP_000143859.1.63757 WP_000143859.1.63766 WP_000143859.1.63781 WP_000143859.1.63797 WP_000143859.1.63816 WP_000143859.1.63824 WP_000143859.1.63834 WP_000143859.1.63851 WP_000143859.1.63863 WP_000143859.1.63864 WP_000143859.1.63876 WP_000143859.1.6389 WP_000143859.1.63901 WP_000143859.1.63934 WP_000143859.1.63955 WP_000143859.1.63963 WP_000143859.1.63977 WP_000143859.1.6399 WP_000143859.1.63992 WP_000143859.1.64007 WP_000143859.1.64018 WP_000143859.1.64032 WP_000143859.1.64034 WP_000143859.1.64046 WP_000143859.1.64085 WP_000143859.1.64087 WP_000143859.1.64109 WP_000143859.1.6415 WP_000143859.1.64157 WP_000143859.1.64229 WP_000143859.1.6423 WP_000143859.1.64242 WP_000143859.1.64244 WP_000143859.1.64293 WP_000143859.1.64294 WP_000143859.1.64332 WP_000143859.1.64350 WP_000143859.1.64374 WP_000143859.1.64376 WP_000143859.1.64385 WP_000143859.1.64387 WP_000143859.1.64389 WP_000143859.1.644 WP_000143859.1.64403 WP_000143859.1.64412 WP_000143859.1.64462 WP_000143859.1.64471 WP_000143859.1.64500 WP_000143859.1.64501 WP_000143859.1.64538 WP_000143859.1.64569 WP_000143859.1.64597 WP_000143859.1.64632 WP_000143859.1.64648 WP_000143859.1.64649 WP_000143859.1.64654 WP_000143859.1.64662 WP_000143859.1.64663 WP_000143859.1.64667 WP_000143859.1.64674 WP_000143859.1.64702 WP_000143859.1.64709 WP_000143859.1.64710 WP_000143859.1.64711 WP_000143859.1.64744 WP_000143859.1.64757 WP_000143859.1.64763 WP_000143859.1.64771 WP_000143859.1.64781 WP_000143859.1.64798 WP_000143859.1.64817 WP_000143859.1.64831 WP_000143859.1.64847 WP_000143859.1.6487 WP_000143859.1.6489 WP_000143859.1.64891 WP_000143859.1.64894 WP_000143859.1.64919 WP_000143859.1.64944 WP_000143859.1.64972 WP_000143859.1.64974 WP_000143859.1.64977 WP_000143859.1.65011 WP_000143859.1.65018 WP_000143859.1.65027 WP_000143859.1.65028 WP_000143859.1.65054 WP_000143859.1.65075 WP_000143859.1.6514 WP_000143859.1.65163 WP_000143859.1.65171 WP_000143859.1.65172 WP_000143859.1.65185 WP_000143859.1.65191 WP_000143859.1.65200 WP_000143859.1.65211 WP_000143859.1.65218 WP_000143859.1.65226 WP_000143859.1.65248 WP_000143859.1.65249 WP_000143859.1.6525 WP_000143859.1.65266 WP_000143859.1.65269 WP_000143859.1.6535 WP_000143859.1.65357 WP_000143859.1.65363 WP_000143859.1.65394 WP_000143859.1.65395 WP_000143859.1.65459 WP_000143859.1.65463 WP_000143859.1.65474 WP_000143859.1.65487 WP_000143859.1.6549 WP_000143859.1.65499 WP_000143859.1.6550 WP_000143859.1.65538 WP_000143859.1.6554 WP_000143859.1.65572 WP_000143859.1.65601 WP_000143859.1.6561 WP_000143859.1.65633 WP_000143859.1.6565 WP_000143859.1.65650 WP_000143859.1.65687 WP_000143859.1.65696 WP_000143859.1.65697 WP_000143859.1.65699 WP_000143859.1.65737 WP_000143859.1.6575 WP_000143859.1.65755 WP_000143859.1.65771 WP_000143859.1.65782 WP_000143859.1.65790 WP_000143859.1.65812 WP_000143859.1.65838 WP_000143859.1.65846 WP_000143859.1.65849 WP_000143859.1.65863 WP_000143859.1.65876 WP_000143859.1.65881 WP_000143859.1.65883 WP_000143859.1.65901 WP_000143859.1.65940 WP_000143859.1.6595 WP_000143859.1.65956 WP_000143859.1.65968 WP_000143859.1.65985 WP_000143859.1.66021 WP_000143859.1.66031 WP_000143859.1.66049 WP_000143859.1.66052 WP_000143859.1.66064 WP_000143859.1.66109 WP_000143859.1.66145 WP_000143859.1.66167 WP_000143859.1.66171 WP_000143859.1.66183 WP_000143859.1.6620 WP_000143859.1.66216 WP_000143859.1.66234 WP_000143859.1.66250 WP_000143859.1.66270 WP_000143859.1.66272 WP_000143859.1.66273 WP_000143859.1.6630 WP_000143859.1.66314 WP_000143859.1.66315 WP_000143859.1.66324 WP_000143859.1.66330 WP_000143859.1.6634 WP_000143859.1.66358 WP_000143859.1.66361 WP_000143859.1.66362 WP_000143859.1.6638 WP_000143859.1.66385 WP_000143859.1.6640 WP_000143859.1.66400 WP_000143859.1.66428 WP_000143859.1.66480 WP_000143859.1.66492 WP_000143859.1.66506 WP_000143859.1.66534 WP_000143859.1.66600 WP_000143859.1.66630 WP_000143859.1.66665 WP_000143859.1.66678 WP_000143859.1.66681 WP_000143859.1.66684 WP_000143859.1.66698 WP_000143859.1.66702 WP_000143859.1.66733 WP_000143859.1.66755 WP_000143859.1.66759 WP_000143859.1.66779 WP_000143859.1.6680 WP_000143859.1.66801 WP_000143859.1.66820 WP_000143859.1.66824 WP_000143859.1.66834 WP_000143859.1.66860 WP_000143859.1.66901 WP_000143859.1.6692 WP_000143859.1.66953 WP_000143859.1.66955 WP_000143859.1.66959 WP_000143859.1.66962 WP_000143859.1.66981 WP_000143859.1.67024 WP_000143859.1.67037 WP_000143859.1.67042 WP_000143859.1.67045 WP_000143859.1.67075 WP_000143859.1.6710 WP_000143859.1.67100 WP_000143859.1.67101 WP_000143859.1.67143 WP_000143859.1.67175 WP_000143859.1.67181 WP_000143859.1.67184 WP_000143859.1.67201 WP_000143859.1.67211 WP_000143859.1.67235 WP_000143859.1.67237 WP_000143859.1.67268 WP_000143859.1.67279 WP_000143859.1.67288 WP_000143859.1.67336 WP_000143859.1.67339 WP_000143859.1.67347 WP_000143859.1.67374 WP_000143859.1.67387 WP_000143859.1.6739 WP_000143859.1.67394 WP_000143859.1.67397 WP_000143859.1.67403 WP_000143859.1.67405 WP_000143859.1.67424 WP_000143859.1.67430 WP_000143859.1.67442 WP_000143859.1.67465 WP_000143859.1.67539 WP_000143859.1.67552 WP_000143859.1.67556 WP_000143859.1.67576 WP_000143859.1.6760 WP_000143859.1.67604 WP_000143859.1.67619 WP_000143859.1.67625 WP_000143859.1.67627 WP_000143859.1.67637 WP_000143859.1.67641 WP_000143859.1.67657 WP_000143859.1.67673 WP_000143859.1.67682 WP_000143859.1.67700 WP_000143859.1.67707 WP_000143859.1.67718 WP_000143859.1.67729 WP_000143859.1.67731 WP_000143859.1.67772 WP_000143859.1.67774 WP_000143859.1.6782 WP_000143859.1.67820 WP_000143859.1.67829 WP_000143859.1.67887 WP_000143859.1.67905 WP_000143859.1.67910 WP_000143859.1.67932 WP_000143859.1.67954 WP_000143859.1.67970 WP_000143859.1.68 WP_000143859.1.68036 WP_000143859.1.68043 WP_000143859.1.68073 WP_000143859.1.68075 WP_000143859.1.68105 WP_000143859.1.68113 WP_000143859.1.68115 WP_000143859.1.68131 WP_000143859.1.68140 WP_000143859.1.68147 WP_000143859.1.68159 WP_000143859.1.68182 WP_000143859.1.6819 WP_000143859.1.68201 WP_000143859.1.68206 WP_000143859.1.6827 WP_000143859.1.68275 WP_000143859.1.68285 WP_000143859.1.68359 WP_000143859.1.68401 WP_000143859.1.68420 WP_000143859.1.68477 WP_000143859.1.68478 WP_000143859.1.6849 WP_000143859.1.685 WP_000143859.1.68514 WP_000143859.1.68532 WP_000143859.1.68547 WP_000143859.1.68564 WP_000143859.1.6858 WP_000143859.1.68589 WP_000143859.1.68591 WP_000143859.1.68652 WP_000143859.1.68655 WP_000143859.1.68656 WP_000143859.1.68677 WP_000143859.1.68688 WP_000143859.1.6869 WP_000143859.1.68742 WP_000143859.1.6875 WP_000143859.1.68770 WP_000143859.1.68778 WP_000143859.1.68787 WP_000143859.1.6879 WP_000143859.1.68809 WP_000143859.1.68818 WP_000143859.1.6883 WP_000143859.1.68893 WP_000143859.1.68894 WP_000143859.1.68895 WP_000143859.1.68914 WP_000143859.1.68928 WP_000143859.1.68975 WP_000143859.1.68999 WP_000143859.1.69001 WP_000143859.1.69006 WP_000143859.1.6904 WP_000143859.1.6905 WP_000143859.1.69053 WP_000143859.1.69058 WP_000143859.1.6907 WP_000143859.1.69080 WP_000143859.1.69086 WP_000143859.1.6913 WP_000143859.1.69131 WP_000143859.1.69146 WP_000143859.1.69151 WP_000143859.1.69170 WP_000143859.1.69210 WP_000143859.1.69236 WP_000143859.1.69255 WP_000143859.1.69270 WP_000143859.1.69282 WP_000143859.1.69288 WP_000143859.1.69296 WP_000143859.1.69357 WP_000143859.1.69371 WP_000143859.1.69376 WP_000143859.1.69385 WP_000143859.1.69396 WP_000143859.1.69397 WP_000143859.1.69465 WP_000143859.1.69466 WP_000143859.1.69485 WP_000143859.1.6954 WP_000143859.1.69564 WP_000143859.1.69575 WP_000143859.1.69592 WP_000143859.1.69597 WP_000143859.1.69611 WP_000143859.1.69616 WP_000143859.1.69636 WP_000143859.1.69642 WP_000143859.1.69644 WP_000143859.1.69656 WP_000143859.1.69657 WP_000143859.1.69690 WP_000143859.1.69696 WP_000143859.1.69704 WP_000143859.1.69754 WP_000143859.1.69758 WP_000143859.1.69767 WP_000143859.1.69790 WP_000143859.1.69817 WP_000143859.1.69890 WP_000143859.1.69923 WP_000143859.1.69948 WP_000143859.1.69953 WP_000143859.1.69965 WP_000143859.1.69982 WP_000143859.1.70010 WP_000143859.1.70049 WP_000143859.1.70058 WP_000143859.1.70061 WP_000143859.1.70088 WP_000143859.1.7014 WP_000143859.1.7016 WP_000143859.1.70205 WP_000143859.1.7021 WP_000143859.1.70240 WP_000143859.1.70241 WP_000143859.1.70249 WP_000143859.1.70261 WP_000143859.1.70269 WP_000143859.1.70272 WP_000143859.1.70289 WP_000143859.1.70290 WP_000143859.1.70314 WP_000143859.1.70321 WP_000143859.1.70326 WP_000143859.1.7033 WP_000143859.1.70427 WP_000143859.1.70433 WP_000143859.1.70440 WP_000143859.1.70447 WP_000143859.1.70485 WP_000143859.1.70523 WP_000143859.1.70545 WP_000143859.1.70547 WP_000143859.1.7055 WP_000143859.1.70596 WP_000143859.1.70623 WP_000143859.1.70643 WP_000143859.1.70644 WP_000143859.1.70671 WP_000143859.1.70678 WP_000143859.1.70679 WP_000143859.1.70683 WP_000143859.1.70685 WP_000143859.1.70708 WP_000143859.1.70712 WP_000143859.1.70717 WP_000143859.1.70731 WP_000143859.1.70772 WP_000143859.1.70785 WP_000143859.1.70792 WP_000143859.1.70797 WP_000143859.1.70837 WP_000143859.1.70845 WP_000143859.1.70846 WP_000143859.1.70869 WP_000143859.1.70883 WP_000143859.1.70922 WP_000143859.1.70948 WP_000143859.1.70959 WP_000143859.1.70969 WP_000143859.1.70981 WP_000143859.1.70985 WP_000143859.1.70995 WP_000143859.1.71007 WP_000143859.1.71023 WP_000143859.1.71039 WP_000143859.1.71057 WP_000143859.1.71069 WP_000143859.1.71081 WP_000143859.1.71088 WP_000143859.1.71116 WP_000143859.1.71117 WP_000143859.1.71120 WP_000143859.1.71146 WP_000143859.1.71150 WP_000143859.1.71165 WP_000143859.1.71172 WP_000143859.1.71184 WP_000143859.1.71186 WP_000143859.1.71188 WP_000143859.1.71201 WP_000143859.1.71202 WP_000143859.1.71243 WP_000143859.1.71268 WP_000143859.1.71299 WP_000143859.1.71305 WP_000143859.1.71306 WP_000143859.1.71337 WP_000143859.1.71363 WP_000143859.1.71368 WP_000143859.1.71378 WP_000143859.1.71401 WP_000143859.1.71407 WP_000143859.1.7142 WP_000143859.1.71446 WP_000143859.1.71455 WP_000143859.1.71456 WP_000143859.1.71481 WP_000143859.1.71487 WP_000143859.1.71523 WP_000143859.1.71542 WP_000143859.1.71566 WP_000143859.1.71626 WP_000143859.1.71636 WP_000143859.1.71640 WP_000143859.1.71649 WP_000143859.1.71651 WP_000143859.1.71653 WP_000143859.1.71691 WP_000143859.1.71702 WP_000143859.1.71716 WP_000143859.1.7174 WP_000143859.1.71746 WP_000143859.1.71750 WP_000143859.1.71756 WP_000143859.1.71798 WP_000143859.1.71845 WP_000143859.1.71872 WP_000143859.1.71881 WP_000143859.1.71908 WP_000143859.1.71941 WP_000143859.1.71950 WP_000143859.1.71952 WP_000143859.1.71954 WP_000143859.1.71973 WP_000143859.1.71979 WP_000143859.1.71985 WP_000143859.1.720 WP_000143859.1.72003 WP_000143859.1.72065 WP_000143859.1.72073 WP_000143859.1.72100 WP_000143859.1.72105 WP_000143859.1.72190 WP_000143859.1.72203 WP_000143859.1.72220 WP_000143859.1.72221 WP_000143859.1.72226 WP_000143859.1.72269 WP_000143859.1.72277 WP_000143859.1.72281 WP_000143859.1.72300 WP_000143859.1.72307 WP_000143859.1.72325 WP_000143859.1.72339 WP_000143859.1.72350 WP_000143859.1.72372 WP_000143859.1.72376 WP_000143859.1.72383 WP_000143859.1.72403 WP_000143859.1.72438 WP_000143859.1.72461 WP_000143859.1.72527 WP_000143859.1.72532 WP_000143859.1.7255 WP_000143859.1.72594 WP_000143859.1.72631 WP_000143859.1.72638 WP_000143859.1.72667 WP_000143859.1.72671 WP_000143859.1.72674 WP_000143859.1.72716 WP_000143859.1.72718 WP_000143859.1.72724 WP_000143859.1.72728 WP_000143859.1.72789 WP_000143859.1.72828 WP_000143859.1.72843 WP_000143859.1.72850 WP_000143859.1.72865 WP_000143859.1.72871 WP_000143859.1.72872 WP_000143859.1.72892 WP_000143859.1.72894 WP_000143859.1.72896 WP_000143859.1.7295 WP_000143859.1.72968 WP_000143859.1.72969 WP_000143859.1.72975 WP_000143859.1.72987 WP_000143859.1.73052 WP_000143859.1.73062 WP_000143859.1.73068 WP_000143859.1.7311 WP_000143859.1.73114 WP_000143859.1.73125 WP_000143859.1.73144 WP_000143859.1.7315 WP_000143859.1.7316 WP_000143859.1.73164 WP_000143859.1.73177 WP_000143859.1.73180 WP_000143859.1.73200 WP_000143859.1.73258 WP_000143859.1.73285 WP_000143859.1.7332 WP_000143859.1.7333 WP_000143859.1.7334 WP_000143859.1.73352 WP_000143859.1.73377 WP_000143859.1.73389 WP_000143859.1.7341 WP_000143859.1.73425 WP_000143859.1.73461 WP_000143859.1.73481 WP_000143859.1.73488 WP_000143859.1.73504 WP_000143859.1.7353 WP_000143859.1.73535 WP_000143859.1.73544 WP_000143859.1.7356 WP_000143859.1.73561 WP_000143859.1.73581 WP_000143859.1.73596 WP_000143859.1.73598 WP_000143859.1.7361 WP_000143859.1.73617 WP_000143859.1.73648 WP_000143859.1.73667 WP_000143859.1.73669 WP_000143859.1.73708 WP_000143859.1.73753 WP_000143859.1.73758 WP_000143859.1.73768 WP_000143859.1.73794 WP_000143859.1.73831 WP_000143859.1.73847 WP_000143859.1.73849 WP_000143859.1.7386 WP_000143859.1.7387 WP_000143859.1.73901 WP_000143859.1.73924 WP_000143859.1.73926 WP_000143859.1.7394 WP_000143859.1.73948 WP_000143859.1.73956 WP_000143859.1.73999 WP_000143859.1.74024 WP_000143859.1.74029 WP_000143859.1.74030 WP_000143859.1.74038 WP_000143859.1.74040 WP_000143859.1.74043 WP_000143859.1.74058 WP_000143859.1.74070 WP_000143859.1.74077 WP_000143859.1.74135 WP_000143859.1.74174 WP_000143859.1.74181 WP_000143859.1.74191 WP_000143859.1.74207 WP_000143859.1.74214 WP_000143859.1.74241 WP_000143859.1.74248 WP_000143859.1.74285 WP_000143859.1.743 WP_000143859.1.7430 WP_000143859.1.74300 WP_000143859.1.74317 WP_000143859.1.7433 WP_000143859.1.74379 WP_000143859.1.74402 WP_000143859.1.74410 WP_000143859.1.74415 WP_000143859.1.74418 WP_000143859.1.7444 WP_000143859.1.74466 WP_000143859.1.745 WP_000143859.1.74500 WP_000143859.1.74529 WP_000143859.1.74545 WP_000143859.1.74570 WP_000143859.1.7458 WP_000143859.1.74616 WP_000143859.1.74620 WP_000143859.1.74621 WP_000143859.1.74644 WP_000143859.1.74647 WP_000143859.1.74677 WP_000143859.1.74699 WP_000143859.1.74702 WP_000143859.1.74745 WP_000143859.1.74757 WP_000143859.1.74806 WP_000143859.1.74826 WP_000143859.1.74831 WP_000143859.1.74894 WP_000143859.1.74929 WP_000143859.1.74939 WP_000143859.1.74972 WP_000143859.1.74973 WP_000143859.1.74996 WP_000143859.1.75051 WP_000143859.1.75056 WP_000143859.1.75058 WP_000143859.1.7507 WP_000143859.1.75089 WP_000143859.1.75114 WP_000143859.1.75116 WP_000143859.1.75129 WP_000143859.1.75148 WP_000143859.1.75159 WP_000143859.1.75187 WP_000143859.1.75237 WP_000143859.1.75273 WP_000143859.1.75288 WP_000143859.1.75296 WP_000143859.1.7531 WP_000143859.1.75334 WP_000143859.1.75385 WP_000143859.1.75392 WP_000143859.1.75400 WP_000143859.1.75402 WP_000143859.1.75413 WP_000143859.1.7543 WP_000143859.1.75433 WP_000143859.1.75450 WP_000143859.1.75494 WP_000143859.1.75532 WP_000143859.1.75565 WP_000143859.1.7558 WP_000143859.1.75585 WP_000143859.1.75593 WP_000143859.1.75607 WP_000143859.1.75610 WP_000143859.1.75626 WP_000143859.1.75633 WP_000143859.1.75664 WP_000143859.1.75716 WP_000143859.1.75718 WP_000143859.1.75745 WP_000143859.1.75751 WP_000143859.1.75760 WP_000143859.1.75764 WP_000143859.1.75793 WP_000143859.1.75794 WP_000143859.1.75810 WP_000143859.1.75828 WP_000143859.1.75837 WP_000143859.1.75844 WP_000143859.1.75863 WP_000143859.1.75874 WP_000143859.1.75884 WP_000143859.1.75886 WP_000143859.1.75898 WP_000143859.1.75902 WP_000143859.1.75932 WP_000143859.1.75945 WP_000143859.1.76020 WP_000143859.1.76024 WP_000143859.1.76055 WP_000143859.1.76081 WP_000143859.1.76097 WP_000143859.1.76102 WP_000143859.1.76108 WP_000143859.1.76116 WP_000143859.1.76122 WP_000143859.1.76137 WP_000143859.1.76156 WP_000143859.1.76170 WP_000143859.1.76186 WP_000143859.1.76197 WP_000143859.1.76208 WP_000143859.1.76252 WP_000143859.1.76256 WP_000143859.1.7629 WP_000143859.1.76327 WP_000143859.1.76339 WP_000143859.1.7634 WP_000143859.1.76345 WP_000143859.1.76364 WP_000143859.1.76366 WP_000143859.1.76417 WP_000143859.1.76434 WP_000143859.1.76445 WP_000143859.1.76451 WP_000143859.1.7646 WP_000143859.1.76471 WP_000143859.1.76495 WP_000143859.1.76510 WP_000143859.1.76529 WP_000143859.1.76532 WP_000143859.1.76558 WP_000143859.1.7657 WP_000143859.1.76572 WP_000143859.1.7660 WP_000143859.1.76641 WP_000143859.1.76651 WP_000143859.1.76653 WP_000143859.1.76673 WP_000143859.1.76706 WP_000143859.1.7672 WP_000143859.1.76721 WP_000143859.1.76756 WP_000143859.1.76760 WP_000143859.1.76776 WP_000143859.1.76788 WP_000143859.1.76806 WP_000143859.1.76854 WP_000143859.1.76875 WP_000143859.1.76880 WP_000143859.1.76899 WP_000143859.1.76913 WP_000143859.1.76916 WP_000143859.1.76932 WP_000143859.1.76968 WP_000143859.1.76973 WP_000143859.1.76988 WP_000143859.1.77016 WP_000143859.1.77033 WP_000143859.1.77038 WP_000143859.1.77047 WP_000143859.1.77080 WP_000143859.1.77087 WP_000143859.1.77090 WP_000143859.1.77111 WP_000143859.1.7712 WP_000143859.1.77177 WP_000143859.1.77180 WP_000143859.1.77184 WP_000143859.1.77244 WP_000143859.1.77267 WP_000143859.1.77292 WP_000143859.1.77299 WP_000143859.1.77306 WP_000143859.1.77313 WP_000143859.1.77349 WP_000143859.1.77356 WP_000143859.1.77384 WP_000143859.1.77475 WP_000143859.1.77496 WP_000143859.1.77501 WP_000143859.1.77512 WP_000143859.1.77513 WP_000143859.1.77514 WP_000143859.1.77529 WP_000143859.1.77543 WP_000143859.1.77549 WP_000143859.1.77555 WP_000143859.1.77563 WP_000143859.1.77565 WP_000143859.1.77596 WP_000143859.1.77646 WP_000143859.1.77692 WP_000143859.1.77702 WP_000143859.1.77710 WP_000143859.1.77713 WP_000143859.1.7772 WP_000143859.1.77729 WP_000143859.1.77761 WP_000143859.1.7782 WP_000143859.1.77825 WP_000143859.1.77837 WP_000143859.1.77846 WP_000143859.1.77851 WP_000143859.1.77898 WP_000143859.1.77900 WP_000143859.1.77918 WP_000143859.1.7792 WP_000143859.1.77923 WP_000143859.1.77951 WP_000143859.1.77960 WP_000143859.1.77975 WP_000143859.1.77983 WP_000143859.1.77989 WP_000143859.1.78016 WP_000143859.1.7802 WP_000143859.1.78026 WP_000143859.1.78033 WP_000143859.1.78035 WP_000143859.1.78048 WP_000143859.1.78051 WP_000143859.1.78053 WP_000143859.1.78076 WP_000143859.1.78096 WP_000143859.1.78100 WP_000143859.1.78107 WP_000143859.1.78110 WP_000143859.1.78120 WP_000143859.1.78166 WP_000143859.1.78168 WP_000143859.1.78192 WP_000143859.1.78195 WP_000143859.1.78201 WP_000143859.1.78291 WP_000143859.1.78309 WP_000143859.1.78320 WP_000143859.1.78339 WP_000143859.1.78366 WP_000143859.1.78372 WP_000143859.1.78382 WP_000143859.1.78383 WP_000143859.1.78388 WP_000143859.1.78407 WP_000143859.1.78410 WP_000143859.1.78501 WP_000143859.1.78502 WP_000143859.1.78602 WP_000143859.1.7861 WP_000143859.1.78618 WP_000143859.1.7862 WP_000143859.1.78626 WP_000143859.1.78632 WP_000143859.1.78658 WP_000143859.1.78661 WP_000143859.1.78673 WP_000143859.1.78674 WP_000143859.1.78676 WP_000143859.1.78697 WP_000143859.1.78715 WP_000143859.1.78734 WP_000143859.1.78735 WP_000143859.1.78761 WP_000143859.1.7877 WP_000143859.1.78771 WP_000143859.1.78802 WP_000143859.1.78815 WP_000143859.1.78830 WP_000143859.1.78835 WP_000143859.1.78838 WP_000143859.1.78871 WP_000143859.1.78874 WP_000143859.1.78877 WP_000143859.1.78896 WP_000143859.1.789 WP_000143859.1.78913 WP_000143859.1.78918 WP_000143859.1.78928 WP_000143859.1.78930 WP_000143859.1.78951 WP_000143859.1.78993 WP_000143859.1.79011 WP_000143859.1.79012 WP_000143859.1.79069 WP_000143859.1.79074 WP_000143859.1.79098 WP_000143859.1.79099 WP_000143859.1.79151 WP_000143859.1.79155 WP_000143859.1.79164 WP_000143859.1.79167 WP_000143859.1.79189 WP_000143859.1.79203 WP_000143859.1.79204 WP_000143859.1.79235 WP_000143859.1.79280 WP_000143859.1.79289 WP_000143859.1.79297 WP_000143859.1.79335 WP_000143859.1.79370 WP_000143859.1.79397 WP_000143859.1.79456 WP_000143859.1.79462 WP_000143859.1.79468 WP_000143859.1.79472 WP_000143859.1.79490 WP_000143859.1.79495 WP_000143859.1.79529 WP_000143859.1.79532 WP_000143859.1.79547 WP_000143859.1.79570 WP_000143859.1.79580 WP_000143859.1.79586 WP_000143859.1.79635 WP_000143859.1.7964 WP_000143859.1.79642 WP_000143859.1.79645 WP_000143859.1.79654 WP_000143859.1.79659 WP_000143859.1.79668 WP_000143859.1.7970 WP_000143859.1.79708 WP_000143859.1.7972 WP_000143859.1.79722 WP_000143859.1.79734 WP_000143859.1.79772 WP_000143859.1.7979 WP_000143859.1.79867 WP_000143859.1.79880 WP_000143859.1.7991 WP_000143859.1.79916 WP_000143859.1.79929 WP_000143859.1.79934 WP_000143859.1.79942 WP_000143859.1.79951 WP_000143859.1.80065 WP_000143859.1.80077 WP_000143859.1.80103 WP_000143859.1.80137 WP_000143859.1.80149 WP_000143859.1.80182 WP_000143859.1.80229 WP_000143859.1.80249 WP_000143859.1.80250 WP_000143859.1.80254 WP_000143859.1.80273 WP_000143859.1.80282 WP_000143859.1.80293 WP_000143859.1.80296 WP_000143859.1.80307 WP_000143859.1.80354 WP_000143859.1.80366 WP_000143859.1.80368 WP_000143859.1.80380 WP_000143859.1.80386 WP_000143859.1.80400 WP_000143859.1.80441 WP_000143859.1.80443 WP_000143859.1.80462 WP_000143859.1.8049 WP_000143859.1.80492 WP_000143859.1.80529 WP_000143859.1.80542 WP_000143859.1.80569 WP_000143859.1.80664 WP_000143859.1.80696 WP_000143859.1.80723 WP_000143859.1.80725 WP_000143859.1.80741 WP_000143859.1.80760 WP_000143859.1.80780 WP_000143859.1.80803 WP_000143859.1.80831 WP_000143859.1.80840 WP_000143859.1.80850 WP_000143859.1.80868 WP_000143859.1.80874 WP_000143859.1.80876 WP_000143859.1.80881 WP_000143859.1.80939 WP_000143859.1.8096 WP_000143859.1.80973 WP_000143859.1.80984 WP_000143859.1.81037 WP_000143859.1.81069 WP_000143859.1.81107 WP_000143859.1.81109 WP_000143859.1.81110 WP_000143859.1.81131 WP_000143859.1.81149 WP_000143859.1.81175 WP_000143859.1.81187 WP_000143859.1.8119 WP_000143859.1.81193 WP_000143859.1.81197 WP_000143859.1.81225 WP_000143859.1.81262 WP_000143859.1.81268 WP_000143859.1.81269 WP_000143859.1.8127 WP_000143859.1.81271 WP_000143859.1.8130 WP_000143859.1.81305 WP_000143859.1.8131 WP_000143859.1.81320 WP_000143859.1.81328 WP_000143859.1.81333 WP_000143859.1.8134 WP_000143859.1.81342 WP_000143859.1.81354 WP_000143859.1.81364 WP_000143859.1.81388 WP_000143859.1.81410 WP_000143859.1.81425 WP_000143859.1.81472 WP_000143859.1.81494 WP_000143859.1.81528 WP_000143859.1.81557 WP_000143859.1.81667 WP_000143859.1.81668 WP_000143859.1.81676 WP_000143859.1.81681 WP_000143859.1.8170 WP_000143859.1.81727 WP_000143859.1.81735 WP_000143859.1.81743 WP_000143859.1.81750 WP_000143859.1.81763 WP_000143859.1.81768 WP_000143859.1.81785 WP_000143859.1.81795 WP_000143859.1.81855 WP_000143859.1.81902 WP_000143859.1.81921 WP_000143859.1.81931 WP_000143859.1.81936 WP_000143859.1.81949 WP_000143859.1.81974 WP_000143859.1.81977 WP_000143859.1.82037 WP_000143859.1.82070 WP_000143859.1.82076 WP_000143859.1.82131 WP_000143859.1.82141 WP_000143859.1.82144 WP_000143859.1.82149 WP_000143859.1.82156 WP_000143859.1.8218 WP_000143859.1.82180 WP_000143859.1.82192 WP_000143859.1.82201 WP_000143859.1.82214 WP_000143859.1.82225 WP_000143859.1.82232 WP_000143859.1.82337 WP_000143859.1.82347 WP_000143859.1.82352 WP_000143859.1.8240 WP_000143859.1.82401 WP_000143859.1.82408 WP_000143859.1.82416 WP_000143859.1.8242 WP_000143859.1.82420 WP_000143859.1.82434 WP_000143859.1.82456 WP_000143859.1.82464 WP_000143859.1.82465 WP_000143859.1.8247 WP_000143859.1.82473 WP_000143859.1.82474 WP_000143859.1.82479 WP_000143859.1.82503 WP_000143859.1.82515 WP_000143859.1.82530 WP_000143859.1.82553 WP_000143859.1.82562 WP_000143859.1.82569 WP_000143859.1.82584 WP_000143859.1.82637 WP_000143859.1.82646 WP_000143859.1.82670 WP_000143859.1.82676 WP_000143859.1.82731 WP_000143859.1.82761 WP_000143859.1.82812 WP_000143859.1.8282 WP_000143859.1.82841 WP_000143859.1.82850 WP_000143859.1.82867 WP_000143859.1.82872 WP_000143859.1.82895 WP_000143859.1.82899 WP_000143859.1.82908 WP_000143859.1.82937 WP_000143859.1.8294 WP_000143859.1.82944 WP_000143859.1.82956 WP_000143859.1.82959 WP_000143859.1.82992 WP_000143859.1.83006 WP_000143859.1.83007 WP_000143859.1.8304 WP_000143859.1.83061 WP_000143859.1.83092 WP_000143859.1.83128 WP_000143859.1.83139 WP_000143859.1.83163 WP_000143859.1.83180 WP_000143859.1.83204 WP_000143859.1.8322 WP_000143859.1.83229 WP_000143859.1.83235 WP_000143859.1.83247 WP_000143859.1.83290 WP_000143859.1.83333 WP_000143859.1.83354 WP_000143859.1.83356 WP_000143859.1.83360 WP_000143859.1.83365 WP_000143859.1.83388 WP_000143859.1.83407 WP_000143859.1.83413 WP_000143859.1.83491 WP_000143859.1.83510 WP_000143859.1.83523 WP_000143859.1.8354 WP_000143859.1.83558 WP_000143859.1.83598 WP_000143859.1.83650 WP_000143859.1.83651 WP_000143859.1.83657 WP_000143859.1.83677 WP_000143859.1.83710 WP_000143859.1.83721 WP_000143859.1.83739 WP_000143859.1.8375 WP_000143859.1.83759 WP_000143859.1.83760 WP_000143859.1.83854 WP_000143859.1.83923 WP_000143859.1.8399 WP_000143859.1.83994 WP_000143859.1.83995 WP_000143859.1.84 WP_000143859.1.84000 WP_000143859.1.84001 WP_000143859.1.84011 WP_000143859.1.84031 WP_000143859.1.8406 WP_000143859.1.84075 WP_000143859.1.84076 WP_000143859.1.84083 WP_000143859.1.84086 WP_000143859.1.84100 WP_000143859.1.84103 WP_000143859.1.84106 WP_000143859.1.84110 WP_000143859.1.84127 WP_000143859.1.84150 WP_000143859.1.84154 WP_000143859.1.84179 WP_000143859.1.84205 WP_000143859.1.84229 WP_000143859.1.84230 WP_000143859.1.84252 WP_000143859.1.84283 WP_000143859.1.84291 WP_000143859.1.84300 WP_000143859.1.8431 WP_000143859.1.84325 WP_000143859.1.84355 WP_000143859.1.84369 WP_000143859.1.84392 WP_000143859.1.84401 WP_000143859.1.84403 WP_000143859.1.8441 WP_000143859.1.84435 WP_000143859.1.84475 WP_000143859.1.84497 WP_000143859.1.84515 WP_000143859.1.84523 WP_000143859.1.84532 WP_000143859.1.84551 WP_000143859.1.84567 WP_000143859.1.84572 WP_000143859.1.84598 WP_000143859.1.84631 WP_000143859.1.84659 WP_000143859.1.84693 WP_000143859.1.84711 WP_000143859.1.84721 WP_000143859.1.84727 WP_000143859.1.84744 WP_000143859.1.84745 WP_000143859.1.84773 WP_000143859.1.84876 WP_000143859.1.84899 WP_000143859.1.84945 WP_000143859.1.84967 WP_000143859.1.8497 WP_000143859.1.84983 WP_000143859.1.850 WP_000143859.1.85004 WP_000143859.1.8502 WP_000143859.1.85031 WP_000143859.1.85039 WP_000143859.1.85040 WP_000143859.1.85079 WP_000143859.1.85120 WP_000143859.1.85126 WP_000143859.1.85134 WP_000143859.1.85153 WP_000143859.1.85178 WP_000143859.1.85180 WP_000143859.1.85190 WP_000143859.1.85192 WP_000143859.1.8526 WP_000143859.1.85271 WP_000143859.1.85273 WP_000143859.1.85301 WP_000143859.1.8533 WP_000143859.1.85338 WP_000143859.1.85339 WP_000143859.1.85469 WP_000143859.1.85481 WP_000143859.1.85483 WP_000143859.1.85511 WP_000143859.1.85512 WP_000143859.1.8552 WP_000143859.1.85541 WP_000143859.1.8556 WP_000143859.1.85568 WP_000143859.1.8557 WP_000143859.1.85606 WP_000143859.1.85615 WP_000143859.1.85617 WP_000143859.1.85635 WP_000143859.1.85646 WP_000143859.1.85654 WP_000143859.1.85663 WP_000143859.1.85665 WP_000143859.1.85669 WP_000143859.1.85671 WP_000143859.1.85672 WP_000143859.1.85688 WP_000143859.1.85703 WP_000143859.1.85728 WP_000143859.1.85746 WP_000143859.1.85759 WP_000143859.1.85777 WP_000143859.1.85784 WP_000143859.1.85811 WP_000143859.1.85854 WP_000143859.1.85855 WP_000143859.1.85864 WP_000143859.1.85886 WP_000143859.1.859 WP_000143859.1.85900 WP_000143859.1.85904 WP_000143859.1.8591 WP_000143859.1.85917 WP_000143859.1.8594 WP_000143859.1.85976 WP_000143859.1.85977 WP_000143859.1.85982 WP_000143859.1.860 WP_000143859.1.86043 WP_000143859.1.8605 WP_000143859.1.86084 WP_000143859.1.86092 WP_000143859.1.8610 WP_000143859.1.86126 WP_000143859.1.86138 WP_000143859.1.8614 WP_000143859.1.86156 WP_000143859.1.86157 WP_000143859.1.8616 WP_000143859.1.86173 WP_000143859.1.86206 WP_000143859.1.86259 WP_000143859.1.86306 WP_000143859.1.86316 WP_000143859.1.86323 WP_000143859.1.86342 WP_000143859.1.86347 WP_000143859.1.86380 WP_000143859.1.8640 WP_000143859.1.8642 WP_000143859.1.86426 WP_000143859.1.86442 WP_000143859.1.86450 WP_000143859.1.86453 WP_000143859.1.86469 WP_000143859.1.8647 WP_000143859.1.86489 WP_000143859.1.86514 WP_000143859.1.86530 WP_000143859.1.86580 WP_000143859.1.86588 WP_000143859.1.86610 WP_000143859.1.86661 WP_000143859.1.86663 WP_000143859.1.86676 WP_000143859.1.8672 WP_000143859.1.86770 WP_000143859.1.8678 WP_000143859.1.86794 WP_000143859.1.86800 WP_000143859.1.86810 WP_000143859.1.86811 WP_000143859.1.86815 WP_000143859.1.8684 WP_000143859.1.86895 WP_000143859.1.86906 WP_000143859.1.86915 WP_000143859.1.86921 WP_000143859.1.86945 WP_000143859.1.86982 WP_000143859.1.86989 WP_000143859.1.87023 WP_000143859.1.87034 WP_000143859.1.87038 WP_000143859.1.87041 WP_000143859.1.87095 WP_000143859.1.87136 WP_000143859.1.87143 WP_000143859.1.87148 WP_000143859.1.87155 WP_000143859.1.87187 WP_000143859.1.87219 WP_000143859.1.8722 WP_000143859.1.87258 WP_000143859.1.87265 WP_000143859.1.87283 WP_000143859.1.87293 WP_000143859.1.87323 WP_000143859.1.8736 WP_000143859.1.87420 WP_000143859.1.87460 WP_000143859.1.87484 WP_000143859.1.87493 WP_000143859.1.87528 WP_000143859.1.87552 WP_000143859.1.87560 WP_000143859.1.87583 WP_000143859.1.8760 WP_000143859.1.87600 WP_000143859.1.87609 WP_000143859.1.87612 WP_000143859.1.87615 WP_000143859.1.87618 WP_000143859.1.87626 WP_000143859.1.87653 WP_000143859.1.87659 WP_000143859.1.87695 WP_000143859.1.87698 WP_000143859.1.87706 WP_000143859.1.87712 WP_000143859.1.87739 WP_000143859.1.87741 WP_000143859.1.87742 WP_000143859.1.87779 WP_000143859.1.87813 WP_000143859.1.87852 WP_000143859.1.87875 WP_000143859.1.87899 WP_000143859.1.87905 WP_000143859.1.8792 WP_000143859.1.87933 WP_000143859.1.87945 WP_000143859.1.87949 WP_000143859.1.87999 WP_000143859.1.88014 WP_000143859.1.88019 WP_000143859.1.88025 WP_000143859.1.88026 WP_000143859.1.8805 WP_000143859.1.88052 WP_000143859.1.8806 WP_000143859.1.88073 WP_000143859.1.8809 WP_000143859.1.88092 WP_000143859.1.881 WP_000143859.1.88136 WP_000143859.1.88145 WP_000143859.1.88185 WP_000143859.1.88199 WP_000143859.1.88244 WP_000143859.1.88275 WP_000143859.1.88291 WP_000143859.1.88293 WP_000143859.1.88299 WP_000143859.1.88313 WP_000143859.1.88356 WP_000143859.1.88359 WP_000143859.1.8837 WP_000143859.1.88393 WP_000143859.1.88407 WP_000143859.1.88414 WP_000143859.1.88444 WP_000143859.1.88446 WP_000143859.1.88458 WP_000143859.1.88474 WP_000143859.1.88501 WP_000143859.1.88508 WP_000143859.1.88538 WP_000143859.1.88547 WP_000143859.1.88597 WP_000143859.1.886 WP_000143859.1.88609 WP_000143859.1.88624 WP_000143859.1.88647 WP_000143859.1.88648 WP_000143859.1.88651 WP_000143859.1.88675 WP_000143859.1.88692 WP_000143859.1.88703 WP_000143859.1.88707 WP_000143859.1.88727 WP_000143859.1.88731 WP_000143859.1.88772 WP_000143859.1.88776 WP_000143859.1.88792 WP_000143859.1.88845 WP_000143859.1.88850 WP_000143859.1.88854 WP_000143859.1.8889 WP_000143859.1.88892 WP_000143859.1.88894 WP_000143859.1.88902 WP_000143859.1.8891 WP_000143859.1.88957 WP_000143859.1.88966 WP_000143859.1.88968 WP_000143859.1.88980 WP_000143859.1.88981 WP_000143859.1.88998 WP_000143859.1.89008 WP_000143859.1.89114 WP_000143859.1.89116 WP_000143859.1.89119 WP_000143859.1.89120 WP_000143859.1.89138 WP_000143859.1.89177 WP_000143859.1.89182 WP_000143859.1.89221 WP_000143859.1.89291 WP_000143859.1.89298 WP_000143859.1.89304 WP_000143859.1.89308 WP_000143859.1.89311 WP_000143859.1.89314 WP_000143859.1.89328 WP_000143859.1.89332 WP_000143859.1.89343 WP_000143859.1.89354 WP_000143859.1.89355 WP_000143859.1.89362 WP_000143859.1.89395 WP_000143859.1.8940 WP_000143859.1.89408 WP_000143859.1.89425 WP_000143859.1.89449 WP_000143859.1.89462 WP_000143859.1.8947 WP_000143859.1.89503 WP_000143859.1.89512 WP_000143859.1.89527 WP_000143859.1.89570 WP_000143859.1.89591 WP_000143859.1.89604 WP_000143859.1.89606 WP_000143859.1.8961 WP_000143859.1.89612 WP_000143859.1.89622 WP_000143859.1.89634 WP_000143859.1.89657 WP_000143859.1.89659 WP_000143859.1.89668 WP_000143859.1.89680 WP_000143859.1.89706 WP_000143859.1.89713 WP_000143859.1.89733 WP_000143859.1.89746 WP_000143859.1.89765 WP_000143859.1.89796 WP_000143859.1.89804 WP_000143859.1.89815 WP_000143859.1.89817 WP_000143859.1.89832 WP_000143859.1.89845 WP_000143859.1.89888 WP_000143859.1.89902 WP_000143859.1.89911 WP_000143859.1.89914 WP_000143859.1.89940 WP_000143859.1.8995 WP_000143859.1.89952 WP_000143859.1.8996 WP_000143859.1.89975 WP_000143859.1.90007 WP_000143859.1.9003 WP_000143859.1.90097 WP_000143859.1.90108 WP_000143859.1.9011 WP_000143859.1.90196 WP_000143859.1.90211 WP_000143859.1.90220 WP_000143859.1.90240 WP_000143859.1.90248 WP_000143859.1.90252 WP_000143859.1.90274 WP_000143859.1.90280 WP_000143859.1.90293 WP_000143859.1.90311 WP_000143859.1.90330 WP_000143859.1.90338 WP_000143859.1.90348 WP_000143859.1.90363 WP_000143859.1.90365 WP_000143859.1.90409 WP_000143859.1.90417 WP_000143859.1.90421 WP_000143859.1.90428 WP_000143859.1.90453 WP_000143859.1.90458 WP_000143859.1.90489 WP_000143859.1.90513 WP_000143859.1.90522 WP_000143859.1.90540 WP_000143859.1.90557 WP_000143859.1.90563 WP_000143859.1.90566 WP_000143859.1.90582 WP_000143859.1.90585 WP_000143859.1.90620 WP_000143859.1.90641 WP_000143859.1.90701 WP_000143859.1.90713 WP_000143859.1.90734 WP_000143859.1.90748 WP_000143859.1.90759 WP_000143859.1.90794 WP_000143859.1.90796 WP_000143859.1.90811 WP_000143859.1.90859 WP_000143859.1.90878 WP_000143859.1.9089 WP_000143859.1.9091 WP_000143859.1.90959 WP_000143859.1.90973 WP_000143859.1.91003 WP_000143859.1.91023 WP_000143859.1.91056 WP_000143859.1.91067 WP_000143859.1.91069 WP_000143859.1.91107 WP_000143859.1.91164 WP_000143859.1.91179 WP_000143859.1.91205 WP_000143859.1.91215 WP_000143859.1.91239 WP_000143859.1.91278 WP_000143859.1.91291 WP_000143859.1.9131 WP_000143859.1.91313 WP_000143859.1.91334 WP_000143859.1.9135 WP_000143859.1.9137 WP_000143859.1.91372 WP_000143859.1.91405 WP_000143859.1.91424 WP_000143859.1.91470 WP_000143859.1.91473 WP_000143859.1.91474 WP_000143859.1.91493 WP_000143859.1.91505 WP_000143859.1.91506 WP_000143859.1.91512 WP_000143859.1.91524 WP_000143859.1.91557 WP_000143859.1.91564 WP_000143859.1.91580 WP_000143859.1.91597 WP_000143859.1.91621 WP_000143859.1.91628 WP_000143859.1.91655 WP_000143859.1.91702 WP_000143859.1.91715 WP_000143859.1.91724 WP_000143859.1.91732 WP_000143859.1.91742 WP_000143859.1.91772 WP_000143859.1.91776 WP_000143859.1.91788 WP_000143859.1.91795 WP_000143859.1.91806 WP_000143859.1.9187 WP_000143859.1.91870 WP_000143859.1.91898 WP_000143859.1.91904 WP_000143859.1.91914 WP_000143859.1.91974 WP_000143859.1.92013 WP_000143859.1.92018 WP_000143859.1.92044 WP_000143859.1.92047 WP_000143859.1.92060 WP_000143859.1.92068 WP_000143859.1.92082 WP_000143859.1.92087 WP_000143859.1.92093 WP_000143859.1.92098 WP_000143859.1.92108 WP_000143859.1.92129 WP_000143859.1.92149 WP_000143859.1.92156 WP_000143859.1.92165 WP_000143859.1.92171 WP_000143859.1.92172 WP_000143859.1.92183 WP_000143859.1.92208 WP_000143859.1.9222 WP_000143859.1.92240 WP_000143859.1.92243 WP_000143859.1.92268 WP_000143859.1.92270 WP_000143859.1.92299 WP_000143859.1.92310 WP_000143859.1.92318 WP_000143859.1.92327 WP_000143859.1.92399 WP_000143859.1.92439 WP_000143859.1.92452 WP_000143859.1.92470 WP_000143859.1.92477 WP_000143859.1.92482 WP_000143859.1.92529 WP_000143859.1.9253 WP_000143859.1.92531 WP_000143859.1.92545 WP_000143859.1.92557 WP_000143859.1.92562 WP_000143859.1.92570 WP_000143859.1.92588 WP_000143859.1.926 WP_000143859.1.92628 WP_000143859.1.92633 WP_000143859.1.92649 WP_000143859.1.92659 WP_000143859.1.92669 WP_000143859.1.92671 WP_000143859.1.92676 WP_000143859.1.92705 WP_000143859.1.9271 WP_000143859.1.92729 WP_000143859.1.92734 WP_000143859.1.92738 WP_000143859.1.92758 WP_000143859.1.92806 WP_000143859.1.92810 WP_000143859.1.92823 WP_000143859.1.92883 WP_000143859.1.92890 WP_000143859.1.92893 WP_000143859.1.92895 WP_000143859.1.92929 WP_000143859.1.92939 WP_000143859.1.92947 WP_000143859.1.92975 WP_000143859.1.92987 WP_000143859.1.93007 WP_000143859.1.93022 WP_000143859.1.93059 WP_000143859.1.93061 WP_000143859.1.93076 WP_000143859.1.93086 WP_000143859.1.93101 WP_000143859.1.93103 WP_000143859.1.93105 WP_000143859.1.93111 WP_000143859.1.93121 WP_000143859.1.93136 WP_000143859.1.93155 WP_000143859.1.93168 WP_000143859.1.93184 WP_000143859.1.93215 WP_000143859.1.93221 WP_000143859.1.93223 WP_000143859.1.93239 WP_000143859.1.93275 WP_000143859.1.93302 WP_000143859.1.93322 WP_000143859.1.93339 WP_000143859.1.93350 WP_000143859.1.9336 WP_000143859.1.93365 WP_000143859.1.93376 WP_000143859.1.93387 WP_000143859.1.93469 WP_000143859.1.93511 WP_000143859.1.93512 WP_000143859.1.93524 WP_000143859.1.93543 WP_000143859.1.93577 WP_000143859.1.93596 WP_000143859.1.93635 WP_000143859.1.93648 WP_000143859.1.93650 WP_000143859.1.93656 WP_000143859.1.93657 WP_000143859.1.93662 WP_000143859.1.937 WP_000143859.1.93705 WP_000143859.1.9374 WP_000143859.1.9375 WP_000143859.1.93754 WP_000143859.1.93761 WP_000143859.1.93767 WP_000143859.1.93780 WP_000143859.1.9380 WP_000143859.1.93803 WP_000143859.1.93804 WP_000143859.1.93809 WP_000143859.1.93828 WP_000143859.1.93842 WP_000143859.1.93843 WP_000143859.1.93875 WP_000143859.1.9389 WP_000143859.1.93909 WP_000143859.1.93919 WP_000143859.1.93937 WP_000143859.1.93938 WP_000143859.1.93984 WP_000143859.1.9399 WP_000143859.1.93994 WP_000143859.1.94017 WP_000143859.1.94064 WP_000143859.1.94072 WP_000143859.1.94079 WP_000143859.1.94097 WP_000143859.1.94107 WP_000143859.1.94132 WP_000143859.1.94142 WP_000143859.1.94162 WP_000143859.1.94167 WP_000143859.1.94168 WP_000143859.1.94198 WP_000143859.1.94215 WP_000143859.1.94303 WP_000143859.1.9432 WP_000143859.1.94354 WP_000143859.1.94365 WP_000143859.1.94379 WP_000143859.1.94380 WP_000143859.1.94390 WP_000143859.1.9440 WP_000143859.1.94412 WP_000143859.1.94415 WP_000143859.1.94458 WP_000143859.1.94492 WP_000143859.1.94510 WP_000143859.1.94527 WP_000143859.1.94557 WP_000143859.1.94562 WP_000143859.1.94565 WP_000143859.1.94573 WP_000143859.1.94579 WP_000143859.1.94584 WP_000143859.1.94586 WP_000143859.1.94588 WP_000143859.1.94593 WP_000143859.1.9463 WP_000143859.1.94649 WP_000143859.1.94650 WP_000143859.1.94655 WP_000143859.1.94659 WP_000143859.1.94662 WP_000143859.1.94670 WP_000143859.1.94674 WP_000143859.1.94700 WP_000143859.1.94722 WP_000143859.1.94745 WP_000143859.1.94782 WP_000143859.1.94796 WP_000143859.1.94815 WP_000143859.1.94817 WP_000143859.1.94820 WP_000143859.1.94835 WP_000143859.1.94849 WP_000143859.1.94850 WP_000143859.1.94851 WP_000143859.1.94862 WP_000143859.1.94864 WP_000143859.1.94947 WP_000143859.1.94952 WP_000143859.1.94959 WP_000143859.1.94967 WP_000143859.1.94971 WP_000143859.1.94986 WP_000143859.1.95006 WP_000143859.1.9503 WP_000143859.1.95051 WP_000143859.1.95055 WP_000143859.1.95076 WP_000143859.1.95085 WP_000143859.1.95099 WP_000143859.1.95121 WP_000143859.1.95136 WP_000143859.1.9516 WP_000143859.1.95165 WP_000143859.1.95171 WP_000143859.1.95235 WP_000143859.1.95239 WP_000143859.1.95246 WP_000143859.1.95248 WP_000143859.1.9525 WP_000143859.1.95255 WP_000143859.1.95265 WP_000143859.1.9527 WP_000143859.1.95277 WP_000143859.1.95282 WP_000143859.1.95289 WP_000143859.1.95298 WP_000143859.1.9530 WP_000143859.1.95320 WP_000143859.1.95338 WP_000143859.1.95388 WP_000143859.1.95412 WP_000143859.1.95434 WP_000143859.1.95447 WP_000143859.1.95456 WP_000143859.1.95465 WP_000143859.1.95530 WP_000143859.1.95546 WP_000143859.1.95547 WP_000143859.1.95590 WP_000143859.1.95607 WP_000143859.1.95625 WP_000143859.1.95630 WP_000143859.1.95641 WP_000143859.1.95656 WP_000143859.1.95670 WP_000143859.1.95675 WP_000143859.1.95691 WP_000143859.1.95716 WP_000143859.1.9574 WP_000143859.1.95744 WP_000143859.1.95757 WP_000143859.1.95776 WP_000143859.1.95803 WP_000143859.1.9586 WP_000143859.1.95866 WP_000143859.1.95884 WP_000143859.1.95890 WP_000143859.1.95901 WP_000143859.1.95906 WP_000143859.1.95911 WP_000143859.1.95939 WP_000143859.1.95940 WP_000143859.1.95963 WP_000143859.1.96004 WP_000143859.1.96025 WP_000143859.1.96044 WP_000143859.1.96045 WP_000143859.1.96054 WP_000143859.1.96094 WP_000143859.1.96107 WP_000143859.1.96127 WP_000143859.1.96139 WP_000143859.1.96144 WP_000143859.1.96162 WP_000143859.1.96188 WP_000143859.1.96206 WP_000143859.1.96211 WP_000143859.1.96212 WP_000143859.1.9624 WP_000143859.1.9627 WP_000143859.1.96317 WP_000143859.1.96319 WP_000143859.1.9633 WP_000143859.1.96340 WP_000143859.1.96343 WP_000143859.1.96348 WP_000143859.1.96349 WP_000143859.1.96359 WP_000143859.1.96380 WP_000143859.1.9644 WP_000143859.1.96469 WP_000143859.1.96497 WP_000143859.1.96500 WP_000143859.1.96521 WP_000143859.1.96533 WP_000143859.1.96537 WP_000143859.1.96539 WP_000143859.1.96552 WP_000143859.1.96555 WP_000143859.1.96563 WP_000143859.1.96588 WP_000143859.1.96610 WP_000143859.1.96625 WP_000143859.1.96635 WP_000143859.1.9664 WP_000143859.1.96662 WP_000143859.1.96675 WP_000143859.1.9670 WP_000143859.1.96721 WP_000143859.1.96732 WP_000143859.1.96735 WP_000143859.1.9674 WP_000143859.1.96750 WP_000143859.1.96758 WP_000143859.1.96761 WP_000143859.1.96771 WP_000143859.1.96792 WP_000143859.1.96798 WP_000143859.1.96801 WP_000143859.1.96803 WP_000143859.1.96810 WP_000143859.1.96876 WP_000143859.1.96902 WP_000143859.1.96925 WP_000143859.1.96938 WP_000143859.1.96946 WP_000143859.1.96957 WP_000143859.1.96978 WP_000143859.1.96993 WP_000143859.1.97005 WP_000143859.1.97015 WP_000143859.1.97026 WP_000143859.1.97028 WP_000143859.1.97047 WP_000143859.1.97079 WP_000143859.1.97103 WP_000143859.1.97143 WP_000143859.1.97145 WP_000143859.1.97154 WP_000143859.1.97184 WP_000143859.1.97190 WP_000143859.1.97287 WP_000143859.1.97291 WP_000143859.1.97297 WP_000143859.1.97318 WP_000143859.1.97322 WP_000143859.1.97328 WP_000143859.1.97337 WP_000143859.1.97369 WP_000143859.1.97422 WP_000143859.1.97441 WP_000143859.1.97477 WP_000143859.1.97487 WP_000143859.1.97497 WP_000143859.1.97505 WP_000143859.1.97547 WP_000143859.1.97594 WP_000143859.1.97597 WP_000143859.1.97599 WP_000143859.1.97606 WP_000143859.1.97613 WP_000143859.1.97615 WP_000143859.1.97620 WP_000143859.1.97626 WP_000143859.1.97631 WP_000143859.1.97646 WP_000143859.1.97648 WP_000143859.1.97656 WP_000143859.1.97690 WP_000143859.1.97691 WP_000143859.1.97704 WP_000143859.1.97725 WP_000143859.1.97727 WP_000143859.1.97732 WP_000143859.1.97736 WP_000143859.1.9774 WP_000143859.1.9775 WP_000143859.1.97772 WP_000143859.1.97800 WP_000143859.1.97819 WP_000143859.1.97840 WP_000143859.1.97846 WP_000143859.1.97873 WP_000143859.1.97907 WP_000143859.1.9793 WP_000143859.1.97938 WP_000143859.1.97981 WP_000143859.1.97983 WP_000143859.1.97986 WP_000143859.1.9799 WP_000143859.1.97991 WP_000143859.1.98006 WP_000143859.1.98019 WP_000143859.1.98022 WP_000143859.1.98036 WP_000143859.1.98080 WP_000143859.1.98086 WP_000143859.1.9811 WP_000143859.1.98110 WP_000143859.1.98119 WP_000143859.1.98146 WP_000143859.1.98158 WP_000143859.1.98170 WP_000143859.1.98201 WP_000143859.1.98219 WP_000143859.1.98250 WP_000143859.1.9826 WP_000143859.1.98263 WP_000143859.1.98338 WP_000143859.1.98392 WP_000143859.1.98402 WP_000143859.1.98403 WP_000143859.1.9841 WP_000143859.1.98418 WP_000143859.1.98438 WP_000143859.1.98440 WP_000143859.1.98446 WP_000143859.1.98448 WP_000143859.1.98457 WP_000143859.1.98472 WP_000143859.1.98495 WP_000143859.1.9850 WP_000143859.1.98502 WP_000143859.1.98513 WP_000143859.1.98531 WP_000143859.1.98577 WP_000143859.1.98607 WP_000143859.1.98627 WP_000143859.1.98676 WP_000143859.1.98677 WP_000143859.1.98726 WP_000143859.1.98731 WP_000143859.1.98751 WP_000143859.1.98760 WP_000143859.1.98762 WP_000143859.1.98763 WP_000143859.1.9877 WP_000143859.1.98801 WP_000143859.1.98818 WP_000143859.1.98843 WP_000143859.1.9887 WP_000143859.1.98899 WP_000143859.1.98931 WP_000143859.1.9898 WP_000143859.1.9899 WP_000143859.1.99057 WP_000143859.1.99071 WP_000143859.1.99072 WP_000143859.1.99083 WP_000143859.1.99097 WP_000143859.1.99098 WP_000143859.1.99107 WP_000143859.1.99163 WP_000143859.1.99164 WP_000143859.1.99184 WP_000143859.1.9919 WP_000143859.1.99198 WP_000143859.1.99215 WP_000143859.1.99267 WP_000143859.1.99276 WP_000143859.1.99335 WP_000143859.1.99350 WP_000143859.1.99360 WP_000143859.1.99363 WP_000143859.1.99369 WP_000143859.1.99370 WP_000143859.1.99388 WP_000143859.1.99397 WP_000143859.1.99463 WP_000143859.1.99469 WP_000143859.1.99483 WP_000143859.1.99490 WP_000143859.1.99493 WP_000143859.1.9954 WP_000143859.1.99546 WP_000143859.1.99579 WP_000143859.1.99595 WP_000143859.1.99613 WP_000143859.1.99626 WP_000143859.1.99630 WP_000143859.1.99637 WP_000143859.1.99646 WP_000143859.1.99657 WP_000143859.1.99660 WP_000143859.1.99671 WP_000143859.1.99676 WP_000143859.1.99712 WP_000143859.1.99725 WP_000143859.1.99747 WP_000143859.1.99764 WP_000143859.1.99813 WP_000143859.1.99824 WP_000143859.1.99829 WP_000143859.1.99837 WP_000143859.1.99841 WP_000143859.1.99858 WP_000143859.1.99889 WP_000143859.1.9992 WP_000143859.1.99924 WP_000143859.1.99958 WP_000143859.1.99961 WP_000143859.1.99996 gi|194451173|ref|YP_002045378.1| ABAM02000001|CDS_1916076-1917296 ABAN01000011|CDS_109129-107909 ABAO01000038|CDS_41214-42434 ABEL01000002|CDS_41505-42725 AE006468|CDS_1456185-1457405 AE014613|CDS_1310867-1312087 AL513382|CDS_1670263-1669043 AM933172|CDS_1773016-1771796 CP001113|CDS_1455600-1456820 CP001120|CDS_1461377-1462597 CP001363|CDS_1466161-1467381 FN424405|CDS_1452697-1453917 NZ_ACBF01000004|CDS_2927-1707 gi|525947462|ref|YP_008308850.1| gi|379700544|ref|YP_005242272.1| gi|528819158|ref|YP_008360361.1| gi|378983930|ref|YP_005247085.1| gi|526220057|ref|YP_008265572.1| gi|29141705|ref|NP_805047.1| gi|488653766|ref|YP_007925569.1| gi|538361953|ref|YP_008505238.1| gi|378444802|ref|YP_005232434.1| gi|378699260|ref|YP_005181217.1| gi|549724009|ref|YP_008644199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]