SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16760592|ref|NP_456209.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16760592|ref|NP_456209.1|
Domain Number 1 Region: 13-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.67e-128
Family GABA-aminotransferase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16760592|ref|NP_456209.1|
Sequence length 408
Comment succinylornithine transaminase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MSLSVTRENFDEWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPAL
REALNEQANRFWHTGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYA
HDRVGNHKSGIVAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALI
DDNTCAVIVEPVQGEGGVIPATNAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMH
YGVTPDILTTAKALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIIN
TPEMQNGVRQRHDAFIERLNTINVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAK
AGVMVLIAGGDVVRFAPALNVSDEEIATGLDRFALACERLQAGGASCG
Download sequence
Identical sequences Q8Z6F9
gi|488653710|ref|YP_007925513.1| AE014613|CDS_1250072-1251298 AL513382|CDS_1731059-1729833 gi|29141648|ref|NP_804990.1| gi|378959349|ref|YP_005216835.1| NP_456209.1.84458 WP_000059512.1.100008 WP_000059512.1.100036 WP_000059512.1.100079 WP_000059512.1.100196 WP_000059512.1.100284 WP_000059512.1.100313 WP_000059512.1.100314 WP_000059512.1.100321 WP_000059512.1.100354 WP_000059512.1.100421 WP_000059512.1.100446 WP_000059512.1.100450 WP_000059512.1.100592 WP_000059512.1.100610 WP_000059512.1.100732 WP_000059512.1.100733 WP_000059512.1.100739 WP_000059512.1.100764 WP_000059512.1.100799 WP_000059512.1.100941 WP_000059512.1.101011 WP_000059512.1.10108 WP_000059512.1.10124 WP_000059512.1.101271 WP_000059512.1.101312 WP_000059512.1.101322 WP_000059512.1.101374 WP_000059512.1.101616 WP_000059512.1.101890 WP_000059512.1.101941 WP_000059512.1.102050 WP_000059512.1.102087 WP_000059512.1.10338 WP_000059512.1.1038 WP_000059512.1.104 WP_000059512.1.10401 WP_000059512.1.10428 WP_000059512.1.10459 WP_000059512.1.10475 WP_000059512.1.10511 WP_000059512.1.10514 WP_000059512.1.10530 WP_000059512.1.10532 WP_000059512.1.10547 WP_000059512.1.10595 WP_000059512.1.10642 WP_000059512.1.10654 WP_000059512.1.10677 WP_000059512.1.10857 WP_000059512.1.10873 WP_000059512.1.10926 WP_000059512.1.10936 WP_000059512.1.11012 WP_000059512.1.11055 WP_000059512.1.11126 WP_000059512.1.11142 WP_000059512.1.11239 WP_000059512.1.11253 WP_000059512.1.11314 WP_000059512.1.11385 WP_000059512.1.1142 WP_000059512.1.11426 WP_000059512.1.11429 WP_000059512.1.11557 WP_000059512.1.11567 WP_000059512.1.11638 WP_000059512.1.11883 WP_000059512.1.11908 WP_000059512.1.11914 WP_000059512.1.12040 WP_000059512.1.12061 WP_000059512.1.1207 WP_000059512.1.12141 WP_000059512.1.12172 WP_000059512.1.12192 WP_000059512.1.1224 WP_000059512.1.12364 WP_000059512.1.12398 WP_000059512.1.12441 WP_000059512.1.12581 WP_000059512.1.12620 WP_000059512.1.12648 WP_000059512.1.12683 WP_000059512.1.12726 WP_000059512.1.12727 WP_000059512.1.12741 WP_000059512.1.12834 WP_000059512.1.13108 WP_000059512.1.13161 WP_000059512.1.1321 WP_000059512.1.13268 WP_000059512.1.13291 WP_000059512.1.133 WP_000059512.1.13314 WP_000059512.1.13338 WP_000059512.1.13342 WP_000059512.1.13352 WP_000059512.1.13406 WP_000059512.1.13440 WP_000059512.1.13443 WP_000059512.1.13476 WP_000059512.1.13599 WP_000059512.1.13686 WP_000059512.1.1372 WP_000059512.1.13732 WP_000059512.1.1382 WP_000059512.1.1397 WP_000059512.1.13972 WP_000059512.1.140 WP_000059512.1.1401 WP_000059512.1.1408 WP_000059512.1.14089 WP_000059512.1.14099 WP_000059512.1.14120 WP_000059512.1.14123 WP_000059512.1.14150 WP_000059512.1.14191 WP_000059512.1.14197 WP_000059512.1.14280 WP_000059512.1.14333 WP_000059512.1.14399 WP_000059512.1.14444 WP_000059512.1.14467 WP_000059512.1.14474 WP_000059512.1.14500 WP_000059512.1.14526 WP_000059512.1.14550 WP_000059512.1.14575 WP_000059512.1.14701 WP_000059512.1.14703 WP_000059512.1.14719 WP_000059512.1.1473 WP_000059512.1.14765 WP_000059512.1.14810 WP_000059512.1.14877 WP_000059512.1.14894 WP_000059512.1.14930 WP_000059512.1.14947 WP_000059512.1.14948 WP_000059512.1.15184 WP_000059512.1.15244 WP_000059512.1.15265 WP_000059512.1.15362 WP_000059512.1.15415 WP_000059512.1.15423 WP_000059512.1.15433 WP_000059512.1.15439 WP_000059512.1.15487 WP_000059512.1.15535 WP_000059512.1.15581 WP_000059512.1.15597 WP_000059512.1.15710 WP_000059512.1.15717 WP_000059512.1.15905 WP_000059512.1.15912 WP_000059512.1.15970 WP_000059512.1.16046 WP_000059512.1.16051 WP_000059512.1.16058 WP_000059512.1.16150 WP_000059512.1.16155 WP_000059512.1.1626 WP_000059512.1.16264 WP_000059512.1.16344 WP_000059512.1.16452 WP_000059512.1.16461 WP_000059512.1.16462 WP_000059512.1.16465 WP_000059512.1.16522 WP_000059512.1.16588 WP_000059512.1.16658 WP_000059512.1.16666 WP_000059512.1.16673 WP_000059512.1.1674 WP_000059512.1.16767 WP_000059512.1.16781 WP_000059512.1.16879 WP_000059512.1.16893 WP_000059512.1.16905 WP_000059512.1.16948 WP_000059512.1.17049 WP_000059512.1.17058 WP_000059512.1.17078 WP_000059512.1.17202 WP_000059512.1.17219 WP_000059512.1.1722 WP_000059512.1.17302 WP_000059512.1.17308 WP_000059512.1.17368 WP_000059512.1.17405 WP_000059512.1.17406 WP_000059512.1.17513 WP_000059512.1.17543 WP_000059512.1.17563 WP_000059512.1.17578 WP_000059512.1.17622 WP_000059512.1.17659 WP_000059512.1.17667 WP_000059512.1.17686 WP_000059512.1.17741 WP_000059512.1.17840 WP_000059512.1.17956 WP_000059512.1.18005 WP_000059512.1.1801 WP_000059512.1.18021 WP_000059512.1.18099 WP_000059512.1.18124 WP_000059512.1.18144 WP_000059512.1.18173 WP_000059512.1.18270 WP_000059512.1.18280 WP_000059512.1.18328 WP_000059512.1.18358 WP_000059512.1.18370 WP_000059512.1.18406 WP_000059512.1.18474 WP_000059512.1.18513 WP_000059512.1.18610 WP_000059512.1.18678 WP_000059512.1.18722 WP_000059512.1.18766 WP_000059512.1.1880 WP_000059512.1.1885 WP_000059512.1.18860 WP_000059512.1.18922 WP_000059512.1.18959 WP_000059512.1.19001 WP_000059512.1.19006 WP_000059512.1.19044 WP_000059512.1.19084 WP_000059512.1.19187 WP_000059512.1.19228 WP_000059512.1.19288 WP_000059512.1.19300 WP_000059512.1.19422 WP_000059512.1.19454 WP_000059512.1.19456 WP_000059512.1.19496 WP_000059512.1.19535 WP_000059512.1.19538 WP_000059512.1.19589 WP_000059512.1.19663 WP_000059512.1.19686 WP_000059512.1.19731 WP_000059512.1.19794 WP_000059512.1.1992 WP_000059512.1.19999 WP_000059512.1.20254 WP_000059512.1.20255 WP_000059512.1.20296 WP_000059512.1.20339 WP_000059512.1.20419 WP_000059512.1.20465 WP_000059512.1.20492 WP_000059512.1.2053 WP_000059512.1.20635 WP_000059512.1.20718 WP_000059512.1.2073 WP_000059512.1.20740 WP_000059512.1.20828 WP_000059512.1.2087 WP_000059512.1.20883 WP_000059512.1.20947 WP_000059512.1.20953 WP_000059512.1.21010 WP_000059512.1.2106 WP_000059512.1.21062 WP_000059512.1.21144 WP_000059512.1.21162 WP_000059512.1.21184 WP_000059512.1.21185 WP_000059512.1.21366 WP_000059512.1.21492 WP_000059512.1.2166 WP_000059512.1.21674 WP_000059512.1.21946 WP_000059512.1.21966 WP_000059512.1.22064 WP_000059512.1.22118 WP_000059512.1.22126 WP_000059512.1.2216 WP_000059512.1.22208 WP_000059512.1.2227 WP_000059512.1.22373 WP_000059512.1.22476 WP_000059512.1.22614 WP_000059512.1.22652 WP_000059512.1.22683 WP_000059512.1.2284 WP_000059512.1.22895 WP_000059512.1.22926 WP_000059512.1.22943 WP_000059512.1.22967 WP_000059512.1.23040 WP_000059512.1.23058 WP_000059512.1.23218 WP_000059512.1.2331 WP_000059512.1.2332 WP_000059512.1.23340 WP_000059512.1.2336 WP_000059512.1.23365 WP_000059512.1.23412 WP_000059512.1.23426 WP_000059512.1.23492 WP_000059512.1.23515 WP_000059512.1.23548 WP_000059512.1.23571 WP_000059512.1.23604 WP_000059512.1.23679 WP_000059512.1.23728 WP_000059512.1.2375 WP_000059512.1.23783 WP_000059512.1.23786 WP_000059512.1.23787 WP_000059512.1.23801 WP_000059512.1.24028 WP_000059512.1.24061 WP_000059512.1.24083 WP_000059512.1.24117 WP_000059512.1.24125 WP_000059512.1.24138 WP_000059512.1.24153 WP_000059512.1.24291 WP_000059512.1.24322 WP_000059512.1.24355 WP_000059512.1.24375 WP_000059512.1.24400 WP_000059512.1.24420 WP_000059512.1.24619 WP_000059512.1.24643 WP_000059512.1.24688 WP_000059512.1.24716 WP_000059512.1.2481 WP_000059512.1.24832 WP_000059512.1.24964 WP_000059512.1.25017 WP_000059512.1.25032 WP_000059512.1.25041 WP_000059512.1.25053 WP_000059512.1.25140 WP_000059512.1.25185 WP_000059512.1.25196 WP_000059512.1.25210 WP_000059512.1.25219 WP_000059512.1.25304 WP_000059512.1.25374 WP_000059512.1.25475 WP_000059512.1.25490 WP_000059512.1.25508 WP_000059512.1.25512 WP_000059512.1.25603 WP_000059512.1.2562 WP_000059512.1.25666 WP_000059512.1.25807 WP_000059512.1.25821 WP_000059512.1.25833 WP_000059512.1.25835 WP_000059512.1.25882 WP_000059512.1.25911 WP_000059512.1.25962 WP_000059512.1.25963 WP_000059512.1.26001 WP_000059512.1.26027 WP_000059512.1.26107 WP_000059512.1.2615 WP_000059512.1.26217 WP_000059512.1.26230 WP_000059512.1.26232 WP_000059512.1.26272 WP_000059512.1.26286 WP_000059512.1.26288 WP_000059512.1.26394 WP_000059512.1.26491 WP_000059512.1.2654 WP_000059512.1.26554 WP_000059512.1.26636 WP_000059512.1.26689 WP_000059512.1.2679 WP_000059512.1.26908 WP_000059512.1.2692 WP_000059512.1.26928 WP_000059512.1.270 WP_000059512.1.27008 WP_000059512.1.27027 WP_000059512.1.27070 WP_000059512.1.27077 WP_000059512.1.27086 WP_000059512.1.27087 WP_000059512.1.27111 WP_000059512.1.27115 WP_000059512.1.2713 WP_000059512.1.2717 WP_000059512.1.27228 WP_000059512.1.27282 WP_000059512.1.27285 WP_000059512.1.27309 WP_000059512.1.27329 WP_000059512.1.27361 WP_000059512.1.27565 WP_000059512.1.27595 WP_000059512.1.27598 WP_000059512.1.27706 WP_000059512.1.27775 WP_000059512.1.27785 WP_000059512.1.27900 WP_000059512.1.27928 WP_000059512.1.27945 WP_000059512.1.28004 WP_000059512.1.2809 WP_000059512.1.28155 WP_000059512.1.28198 WP_000059512.1.2822 WP_000059512.1.28229 WP_000059512.1.28384 WP_000059512.1.28386 WP_000059512.1.28395 WP_000059512.1.284 WP_000059512.1.2845 WP_000059512.1.28479 WP_000059512.1.28627 WP_000059512.1.28692 WP_000059512.1.2873 WP_000059512.1.28917 WP_000059512.1.28962 WP_000059512.1.29023 WP_000059512.1.29042 WP_000059512.1.2905 WP_000059512.1.2907 WP_000059512.1.29081 WP_000059512.1.29089 WP_000059512.1.29153 WP_000059512.1.29203 WP_000059512.1.29237 WP_000059512.1.29248 WP_000059512.1.29288 WP_000059512.1.29389 WP_000059512.1.29439 WP_000059512.1.2946 WP_000059512.1.29462 WP_000059512.1.29563 WP_000059512.1.29727 WP_000059512.1.29743 WP_000059512.1.29782 WP_000059512.1.29833 WP_000059512.1.29851 WP_000059512.1.29865 WP_000059512.1.29886 WP_000059512.1.29919 WP_000059512.1.2994 WP_000059512.1.29964 WP_000059512.1.29983 WP_000059512.1.30009 WP_000059512.1.30013 WP_000059512.1.3002 WP_000059512.1.30034 WP_000059512.1.30049 WP_000059512.1.30058 WP_000059512.1.30172 WP_000059512.1.30185 WP_000059512.1.30354 WP_000059512.1.30357 WP_000059512.1.30362 WP_000059512.1.3042 WP_000059512.1.30421 WP_000059512.1.30440 WP_000059512.1.30448 WP_000059512.1.30489 WP_000059512.1.30517 WP_000059512.1.30542 WP_000059512.1.30544 WP_000059512.1.30556 WP_000059512.1.30572 WP_000059512.1.30585 WP_000059512.1.30618 WP_000059512.1.30664 WP_000059512.1.30688 WP_000059512.1.30806 WP_000059512.1.30967 WP_000059512.1.31046 WP_000059512.1.31066 WP_000059512.1.31078 WP_000059512.1.31139 WP_000059512.1.31145 WP_000059512.1.31182 WP_000059512.1.31205 WP_000059512.1.3121 WP_000059512.1.31223 WP_000059512.1.31303 WP_000059512.1.3131 WP_000059512.1.31352 WP_000059512.1.31389 WP_000059512.1.31413 WP_000059512.1.31446 WP_000059512.1.31533 WP_000059512.1.31799 WP_000059512.1.31836 WP_000059512.1.31951 WP_000059512.1.32041 WP_000059512.1.32042 WP_000059512.1.3207 WP_000059512.1.32189 WP_000059512.1.32202 WP_000059512.1.32263 WP_000059512.1.32293 WP_000059512.1.32299 WP_000059512.1.32422 WP_000059512.1.32425 WP_000059512.1.32458 WP_000059512.1.32460 WP_000059512.1.32529 WP_000059512.1.32563 WP_000059512.1.32578 WP_000059512.1.32617 WP_000059512.1.3270 WP_000059512.1.32725 WP_000059512.1.32838 WP_000059512.1.32848 WP_000059512.1.32868 WP_000059512.1.3290 WP_000059512.1.32940 WP_000059512.1.32941 WP_000059512.1.3296 WP_000059512.1.32966 WP_000059512.1.32985 WP_000059512.1.33037 WP_000059512.1.3305 WP_000059512.1.33051 WP_000059512.1.33065 WP_000059512.1.33122 WP_000059512.1.3315 WP_000059512.1.33208 WP_000059512.1.33214 WP_000059512.1.33247 WP_000059512.1.33280 WP_000059512.1.33283 WP_000059512.1.33313 WP_000059512.1.33339 WP_000059512.1.33382 WP_000059512.1.33490 WP_000059512.1.33501 WP_000059512.1.33529 WP_000059512.1.33689 WP_000059512.1.3370 WP_000059512.1.33730 WP_000059512.1.33741 WP_000059512.1.33840 WP_000059512.1.3392 WP_000059512.1.33926 WP_000059512.1.33957 WP_000059512.1.33969 WP_000059512.1.34001 WP_000059512.1.34059 WP_000059512.1.34118 WP_000059512.1.34211 WP_000059512.1.34214 WP_000059512.1.34234 WP_000059512.1.34284 WP_000059512.1.34376 WP_000059512.1.34382 WP_000059512.1.34484 WP_000059512.1.34517 WP_000059512.1.34530 WP_000059512.1.34665 WP_000059512.1.34694 WP_000059512.1.34751 WP_000059512.1.34808 WP_000059512.1.34824 WP_000059512.1.34834 WP_000059512.1.34932 WP_000059512.1.34962 WP_000059512.1.35001 WP_000059512.1.35040 WP_000059512.1.35074 WP_000059512.1.35175 WP_000059512.1.35240 WP_000059512.1.35274 WP_000059512.1.35532 WP_000059512.1.35560 WP_000059512.1.3557 WP_000059512.1.35628 WP_000059512.1.3570 WP_000059512.1.35712 WP_000059512.1.35713 WP_000059512.1.35736 WP_000059512.1.35791 WP_000059512.1.35795 WP_000059512.1.35870 WP_000059512.1.35916 WP_000059512.1.35938 WP_000059512.1.35966 WP_000059512.1.36000 WP_000059512.1.36034 WP_000059512.1.36036 WP_000059512.1.36069 WP_000059512.1.36291 WP_000059512.1.36298 WP_000059512.1.36308 WP_000059512.1.36323 WP_000059512.1.36343 WP_000059512.1.36460 WP_000059512.1.3649 WP_000059512.1.36495 WP_000059512.1.36526 WP_000059512.1.36567 WP_000059512.1.36579 WP_000059512.1.36617 WP_000059512.1.36618 WP_000059512.1.36643 WP_000059512.1.36663 WP_000059512.1.36701 WP_000059512.1.36725 WP_000059512.1.36779 WP_000059512.1.36798 WP_000059512.1.36802 WP_000059512.1.36821 WP_000059512.1.36853 WP_000059512.1.36950 WP_000059512.1.37014 WP_000059512.1.37133 WP_000059512.1.37176 WP_000059512.1.37199 WP_000059512.1.37200 WP_000059512.1.37258 WP_000059512.1.37303 WP_000059512.1.37513 WP_000059512.1.37584 WP_000059512.1.37590 WP_000059512.1.37593 WP_000059512.1.37600 WP_000059512.1.37613 WP_000059512.1.37659 WP_000059512.1.37662 WP_000059512.1.37675 WP_000059512.1.37691 WP_000059512.1.37761 WP_000059512.1.37775 WP_000059512.1.37777 WP_000059512.1.378 WP_000059512.1.379 WP_000059512.1.37911 WP_000059512.1.37941 WP_000059512.1.37985 WP_000059512.1.38061 WP_000059512.1.38064 WP_000059512.1.38108 WP_000059512.1.3816 WP_000059512.1.38207 WP_000059512.1.38261 WP_000059512.1.38266 WP_000059512.1.38310 WP_000059512.1.3834 WP_000059512.1.3838 WP_000059512.1.38381 WP_000059512.1.38440 WP_000059512.1.38486 WP_000059512.1.38515 WP_000059512.1.38595 WP_000059512.1.3860 WP_000059512.1.38642 WP_000059512.1.38734 WP_000059512.1.38877 WP_000059512.1.38983 WP_000059512.1.38996 WP_000059512.1.39056 WP_000059512.1.3907 WP_000059512.1.39105 WP_000059512.1.3914 WP_000059512.1.39147 WP_000059512.1.39161 WP_000059512.1.39210 WP_000059512.1.39235 WP_000059512.1.3931 WP_000059512.1.39435 WP_000059512.1.39502 WP_000059512.1.39530 WP_000059512.1.39619 WP_000059512.1.39620 WP_000059512.1.39624 WP_000059512.1.39659 WP_000059512.1.39667 WP_000059512.1.39775 WP_000059512.1.39879 WP_000059512.1.39890 WP_000059512.1.39941 WP_000059512.1.39945 WP_000059512.1.39947 WP_000059512.1.40095 WP_000059512.1.40097 WP_000059512.1.401 WP_000059512.1.40160 WP_000059512.1.40167 WP_000059512.1.40279 WP_000059512.1.40361 WP_000059512.1.4042 WP_000059512.1.40467 WP_000059512.1.40496 WP_000059512.1.40517 WP_000059512.1.40698 WP_000059512.1.40750 WP_000059512.1.40763 WP_000059512.1.40854 WP_000059512.1.4089 WP_000059512.1.40924 WP_000059512.1.40932 WP_000059512.1.40946 WP_000059512.1.41004 WP_000059512.1.4106 WP_000059512.1.41070 WP_000059512.1.41074 WP_000059512.1.41075 WP_000059512.1.41097 WP_000059512.1.41132 WP_000059512.1.41176 WP_000059512.1.41251 WP_000059512.1.41258 WP_000059512.1.41305 WP_000059512.1.41321 WP_000059512.1.41333 WP_000059512.1.41335 WP_000059512.1.4136 WP_000059512.1.41415 WP_000059512.1.41459 WP_000059512.1.41498 WP_000059512.1.41519 WP_000059512.1.41524 WP_000059512.1.41631 WP_000059512.1.41658 WP_000059512.1.41659 WP_000059512.1.41716 WP_000059512.1.41746 WP_000059512.1.41824 WP_000059512.1.41825 WP_000059512.1.41836 WP_000059512.1.41894 WP_000059512.1.41919 WP_000059512.1.41929 WP_000059512.1.4194 WP_000059512.1.42069 WP_000059512.1.42081 WP_000059512.1.42090 WP_000059512.1.42111 WP_000059512.1.42187 WP_000059512.1.42200 WP_000059512.1.42219 WP_000059512.1.42257 WP_000059512.1.42261 WP_000059512.1.42349 WP_000059512.1.42364 WP_000059512.1.42371 WP_000059512.1.42379 WP_000059512.1.42391 WP_000059512.1.42399 WP_000059512.1.42539 WP_000059512.1.42603 WP_000059512.1.42650 WP_000059512.1.4267 WP_000059512.1.42701 WP_000059512.1.42805 WP_000059512.1.42815 WP_000059512.1.42859 WP_000059512.1.4298 WP_000059512.1.43008 WP_000059512.1.43016 WP_000059512.1.43019 WP_000059512.1.43065 WP_000059512.1.43068 WP_000059512.1.43069 WP_000059512.1.43128 WP_000059512.1.43141 WP_000059512.1.43157 WP_000059512.1.43161 WP_000059512.1.43190 WP_000059512.1.43198 WP_000059512.1.4326 WP_000059512.1.43290 WP_000059512.1.43292 WP_000059512.1.43307 WP_000059512.1.43513 WP_000059512.1.43633 WP_000059512.1.43637 WP_000059512.1.43651 WP_000059512.1.43722 WP_000059512.1.43801 WP_000059512.1.43812 WP_000059512.1.43878 WP_000059512.1.43888 WP_000059512.1.43919 WP_000059512.1.43974 WP_000059512.1.44049 WP_000059512.1.44101 WP_000059512.1.44160 WP_000059512.1.44180 WP_000059512.1.44196 WP_000059512.1.44248 WP_000059512.1.44262 WP_000059512.1.44268 WP_000059512.1.4427 WP_000059512.1.44296 WP_000059512.1.44343 WP_000059512.1.44351 WP_000059512.1.44360 WP_000059512.1.44416 WP_000059512.1.44431 WP_000059512.1.44437 WP_000059512.1.44546 WP_000059512.1.4468 WP_000059512.1.44762 WP_000059512.1.44815 WP_000059512.1.44828 WP_000059512.1.44879 WP_000059512.1.44917 WP_000059512.1.4501 WP_000059512.1.45072 WP_000059512.1.45093 WP_000059512.1.45136 WP_000059512.1.45241 WP_000059512.1.45435 WP_000059512.1.45523 WP_000059512.1.45596 WP_000059512.1.45648 WP_000059512.1.45829 WP_000059512.1.45871 WP_000059512.1.46030 WP_000059512.1.46077 WP_000059512.1.46169 WP_000059512.1.46225 WP_000059512.1.46241 WP_000059512.1.46307 WP_000059512.1.46355 WP_000059512.1.464 WP_000059512.1.46454 WP_000059512.1.46461 WP_000059512.1.46504 WP_000059512.1.46505 WP_000059512.1.46551 WP_000059512.1.46559 WP_000059512.1.46701 WP_000059512.1.46781 WP_000059512.1.46816 WP_000059512.1.46842 WP_000059512.1.4690 WP_000059512.1.46920 WP_000059512.1.46945 WP_000059512.1.47036 WP_000059512.1.47037 WP_000059512.1.47042 WP_000059512.1.47059 WP_000059512.1.47085 WP_000059512.1.47123 WP_000059512.1.47215 WP_000059512.1.47245 WP_000059512.1.47523 WP_000059512.1.47531 WP_000059512.1.47532 WP_000059512.1.47605 WP_000059512.1.47630 WP_000059512.1.4774 WP_000059512.1.47756 WP_000059512.1.4781 WP_000059512.1.47886 WP_000059512.1.47898 WP_000059512.1.48019 WP_000059512.1.48100 WP_000059512.1.48114 WP_000059512.1.48139 WP_000059512.1.48190 WP_000059512.1.48292 WP_000059512.1.48324 WP_000059512.1.48426 WP_000059512.1.48430 WP_000059512.1.48436 WP_000059512.1.48586 WP_000059512.1.4859 WP_000059512.1.48591 WP_000059512.1.48610 WP_000059512.1.48631 WP_000059512.1.48663 WP_000059512.1.48690 WP_000059512.1.48734 WP_000059512.1.48756 WP_000059512.1.48778 WP_000059512.1.48849 WP_000059512.1.48955 WP_000059512.1.48963 WP_000059512.1.48973 WP_000059512.1.49004 WP_000059512.1.49106 WP_000059512.1.49117 WP_000059512.1.49121 WP_000059512.1.4914 WP_000059512.1.49140 WP_000059512.1.49153 WP_000059512.1.49166 WP_000059512.1.49355 WP_000059512.1.49429 WP_000059512.1.49434 WP_000059512.1.49450 WP_000059512.1.495 WP_000059512.1.49545 WP_000059512.1.49703 WP_000059512.1.49769 WP_000059512.1.49846 WP_000059512.1.4991 WP_000059512.1.49947 WP_000059512.1.49959 WP_000059512.1.49997 WP_000059512.1.50014 WP_000059512.1.50030 WP_000059512.1.50043 WP_000059512.1.50103 WP_000059512.1.50158 WP_000059512.1.50247 WP_000059512.1.50308 WP_000059512.1.50309 WP_000059512.1.50387 WP_000059512.1.50406 WP_000059512.1.50468 WP_000059512.1.5051 WP_000059512.1.50566 WP_000059512.1.50570 WP_000059512.1.50626 WP_000059512.1.50726 WP_000059512.1.50771 WP_000059512.1.50875 WP_000059512.1.50885 WP_000059512.1.509 WP_000059512.1.50929 WP_000059512.1.50970 WP_000059512.1.51040 WP_000059512.1.51048 WP_000059512.1.51100 WP_000059512.1.51134 WP_000059512.1.51227 WP_000059512.1.5127 WP_000059512.1.51305 WP_000059512.1.51315 WP_000059512.1.5136 WP_000059512.1.51474 WP_000059512.1.51519 WP_000059512.1.51598 WP_000059512.1.51644 WP_000059512.1.51724 WP_000059512.1.51734 WP_000059512.1.51838 WP_000059512.1.51863 WP_000059512.1.51935 WP_000059512.1.52057 WP_000059512.1.52114 WP_000059512.1.52129 WP_000059512.1.52191 WP_000059512.1.52202 WP_000059512.1.52209 WP_000059512.1.52339 WP_000059512.1.52469 WP_000059512.1.52571 WP_000059512.1.526 WP_000059512.1.52647 WP_000059512.1.52742 WP_000059512.1.52773 WP_000059512.1.52795 WP_000059512.1.52807 WP_000059512.1.52887 WP_000059512.1.53092 WP_000059512.1.53141 WP_000059512.1.53151 WP_000059512.1.53154 WP_000059512.1.53159 WP_000059512.1.53210 WP_000059512.1.53233 WP_000059512.1.53307 WP_000059512.1.53321 WP_000059512.1.53368 WP_000059512.1.53375 WP_000059512.1.53450 WP_000059512.1.5349 WP_000059512.1.53540 WP_000059512.1.53555 WP_000059512.1.53559 WP_000059512.1.5356 WP_000059512.1.53571 WP_000059512.1.5358 WP_000059512.1.53692 WP_000059512.1.53723 WP_000059512.1.5374 WP_000059512.1.53750 WP_000059512.1.53800 WP_000059512.1.53815 WP_000059512.1.53839 WP_000059512.1.53892 WP_000059512.1.53898 WP_000059512.1.53902 WP_000059512.1.53958 WP_000059512.1.53981 WP_000059512.1.53984 WP_000059512.1.54132 WP_000059512.1.54170 WP_000059512.1.54175 WP_000059512.1.54203 WP_000059512.1.54259 WP_000059512.1.5430 WP_000059512.1.54371 WP_000059512.1.54431 WP_000059512.1.54442 WP_000059512.1.54482 WP_000059512.1.54589 WP_000059512.1.54667 WP_000059512.1.54678 WP_000059512.1.54681 WP_000059512.1.54748 WP_000059512.1.5481 WP_000059512.1.54865 WP_000059512.1.54935 WP_000059512.1.54979 WP_000059512.1.55010 WP_000059512.1.55034 WP_000059512.1.55163 WP_000059512.1.55165 WP_000059512.1.55215 WP_000059512.1.55290 WP_000059512.1.55310 WP_000059512.1.55317 WP_000059512.1.55379 WP_000059512.1.5539 WP_000059512.1.55468 WP_000059512.1.55506 WP_000059512.1.55604 WP_000059512.1.55639 WP_000059512.1.55699 WP_000059512.1.55725 WP_000059512.1.55780 WP_000059512.1.55967 WP_000059512.1.56144 WP_000059512.1.56172 WP_000059512.1.5621 WP_000059512.1.56226 WP_000059512.1.56311 WP_000059512.1.56419 WP_000059512.1.56423 WP_000059512.1.56514 WP_000059512.1.56535 WP_000059512.1.56585 WP_000059512.1.56640 WP_000059512.1.56724 WP_000059512.1.56825 WP_000059512.1.56887 WP_000059512.1.56889 WP_000059512.1.56981 WP_000059512.1.57101 WP_000059512.1.57137 WP_000059512.1.57147 WP_000059512.1.57179 WP_000059512.1.57186 WP_000059512.1.57342 WP_000059512.1.57684 WP_000059512.1.57699 WP_000059512.1.57785 WP_000059512.1.57800 WP_000059512.1.57873 WP_000059512.1.57965 WP_000059512.1.57972 WP_000059512.1.58008 WP_000059512.1.58044 WP_000059512.1.58081 WP_000059512.1.5809 WP_000059512.1.58132 WP_000059512.1.58173 WP_000059512.1.58191 WP_000059512.1.58194 WP_000059512.1.58252 WP_000059512.1.58261 WP_000059512.1.58274 WP_000059512.1.58282 WP_000059512.1.58324 WP_000059512.1.58326 WP_000059512.1.5836 WP_000059512.1.58485 WP_000059512.1.58537 WP_000059512.1.58568 WP_000059512.1.58583 WP_000059512.1.58652 WP_000059512.1.58663 WP_000059512.1.58724 WP_000059512.1.5875 WP_000059512.1.58796 WP_000059512.1.58807 WP_000059512.1.58847 WP_000059512.1.58883 WP_000059512.1.58898 WP_000059512.1.58949 WP_000059512.1.58963 WP_000059512.1.58970 WP_000059512.1.58974 WP_000059512.1.59020 WP_000059512.1.59043 WP_000059512.1.59056 WP_000059512.1.59061 WP_000059512.1.59064 WP_000059512.1.59282 WP_000059512.1.59299 WP_000059512.1.59313 WP_000059512.1.5949 WP_000059512.1.59501 WP_000059512.1.59510 WP_000059512.1.5969 WP_000059512.1.59751 WP_000059512.1.59827 WP_000059512.1.59829 WP_000059512.1.59847 WP_000059512.1.59863 WP_000059512.1.59969 WP_000059512.1.59994 WP_000059512.1.60045 WP_000059512.1.60076 WP_000059512.1.60114 WP_000059512.1.60154 WP_000059512.1.60168 WP_000059512.1.60192 WP_000059512.1.60199 WP_000059512.1.60212 WP_000059512.1.60253 WP_000059512.1.60322 WP_000059512.1.60324 WP_000059512.1.60356 WP_000059512.1.6038 WP_000059512.1.60380 WP_000059512.1.6041 WP_000059512.1.60424 WP_000059512.1.60481 WP_000059512.1.605 WP_000059512.1.6058 WP_000059512.1.60584 WP_000059512.1.6060 WP_000059512.1.60708 WP_000059512.1.60725 WP_000059512.1.60783 WP_000059512.1.60792 WP_000059512.1.60807 WP_000059512.1.60882 WP_000059512.1.60889 WP_000059512.1.60950 WP_000059512.1.6104 WP_000059512.1.61044 WP_000059512.1.61076 WP_000059512.1.61123 WP_000059512.1.61147 WP_000059512.1.61168 WP_000059512.1.61210 WP_000059512.1.61357 WP_000059512.1.61511 WP_000059512.1.61539 WP_000059512.1.61542 WP_000059512.1.61553 WP_000059512.1.61649 WP_000059512.1.61652 WP_000059512.1.61697 WP_000059512.1.61809 WP_000059512.1.61877 WP_000059512.1.61920 WP_000059512.1.62124 WP_000059512.1.62199 WP_000059512.1.62223 WP_000059512.1.62302 WP_000059512.1.62314 WP_000059512.1.62323 WP_000059512.1.62333 WP_000059512.1.62338 WP_000059512.1.62380 WP_000059512.1.62411 WP_000059512.1.62436 WP_000059512.1.62475 WP_000059512.1.62536 WP_000059512.1.62640 WP_000059512.1.62686 WP_000059512.1.62751 WP_000059512.1.62825 WP_000059512.1.62913 WP_000059512.1.62932 WP_000059512.1.62960 WP_000059512.1.63016 WP_000059512.1.63025 WP_000059512.1.63069 WP_000059512.1.63087 WP_000059512.1.63169 WP_000059512.1.63297 WP_000059512.1.63448 WP_000059512.1.63514 WP_000059512.1.63583 WP_000059512.1.63592 WP_000059512.1.63663 WP_000059512.1.63736 WP_000059512.1.63816 WP_000059512.1.63876 WP_000059512.1.6389 WP_000059512.1.63901 WP_000059512.1.63955 WP_000059512.1.63963 WP_000059512.1.64032 WP_000059512.1.64087 WP_000059512.1.6415 WP_000059512.1.64293 WP_000059512.1.64332 WP_000059512.1.64376 WP_000059512.1.644 WP_000059512.1.64471 WP_000059512.1.64501 WP_000059512.1.64538 WP_000059512.1.64632 WP_000059512.1.64648 WP_000059512.1.64654 WP_000059512.1.64662 WP_000059512.1.64663 WP_000059512.1.64709 WP_000059512.1.64710 WP_000059512.1.64744 WP_000059512.1.64763 WP_000059512.1.64817 WP_000059512.1.64847 WP_000059512.1.6487 WP_000059512.1.64891 WP_000059512.1.64974 WP_000059512.1.65054 WP_000059512.1.65075 WP_000059512.1.6514 WP_000059512.1.65172 WP_000059512.1.65191 WP_000059512.1.65200 WP_000059512.1.65211 WP_000059512.1.65218 WP_000059512.1.65226 WP_000059512.1.65249 WP_000059512.1.65266 WP_000059512.1.65395 WP_000059512.1.65459 WP_000059512.1.65463 WP_000059512.1.65487 WP_000059512.1.6549 WP_000059512.1.65499 WP_000059512.1.6554 WP_000059512.1.65650 WP_000059512.1.65697 WP_000059512.1.65699 WP_000059512.1.65737 WP_000059512.1.65755 WP_000059512.1.65812 WP_000059512.1.65846 WP_000059512.1.65863 WP_000059512.1.65985 WP_000059512.1.66021 WP_000059512.1.66031 WP_000059512.1.66052 WP_000059512.1.66064 WP_000059512.1.66109 WP_000059512.1.66145 WP_000059512.1.66183 WP_000059512.1.6620 WP_000059512.1.66216 WP_000059512.1.66234 WP_000059512.1.66273 WP_000059512.1.66324 WP_000059512.1.6634 WP_000059512.1.66361 WP_000059512.1.66480 WP_000059512.1.66506 WP_000059512.1.66665 WP_000059512.1.66681 WP_000059512.1.66684 WP_000059512.1.66755 WP_000059512.1.66759 WP_000059512.1.66801 WP_000059512.1.66860 WP_000059512.1.66953 WP_000059512.1.66955 WP_000059512.1.66981 WP_000059512.1.67024 WP_000059512.1.67042 WP_000059512.1.67101 WP_000059512.1.67143 WP_000059512.1.67201 WP_000059512.1.67211 WP_000059512.1.67237 WP_000059512.1.67336 WP_000059512.1.67339 WP_000059512.1.67387 WP_000059512.1.67394 WP_000059512.1.67397 WP_000059512.1.67403 WP_000059512.1.67430 WP_000059512.1.67442 WP_000059512.1.67539 WP_000059512.1.67556 WP_000059512.1.67576 WP_000059512.1.67604 WP_000059512.1.67619 WP_000059512.1.67625 WP_000059512.1.67627 WP_000059512.1.67641 WP_000059512.1.67657 WP_000059512.1.67673 WP_000059512.1.67700 WP_000059512.1.67718 WP_000059512.1.67729 WP_000059512.1.67774 WP_000059512.1.67820 WP_000059512.1.67910 WP_000059512.1.67954 WP_000059512.1.68 WP_000059512.1.68043 WP_000059512.1.68105 WP_000059512.1.68113 WP_000059512.1.68131 WP_000059512.1.68182 WP_000059512.1.6819 WP_000059512.1.68285 WP_000059512.1.68359 WP_000059512.1.68420 WP_000059512.1.68514 WP_000059512.1.68564 WP_000059512.1.68688 WP_000059512.1.68742 WP_000059512.1.68770 WP_000059512.1.68809 WP_000059512.1.68914 WP_000059512.1.69053 WP_000059512.1.69170 WP_000059512.1.69210 WP_000059512.1.69270 WP_000059512.1.69282 WP_000059512.1.69376 WP_000059512.1.69396 WP_000059512.1.69466 WP_000059512.1.69611 WP_000059512.1.69642 WP_000059512.1.69656 WP_000059512.1.69657 WP_000059512.1.69690 WP_000059512.1.69923 WP_000059512.1.69948 WP_000059512.1.69953 WP_000059512.1.70010 WP_000059512.1.70049 WP_000059512.1.70058 WP_000059512.1.70061 WP_000059512.1.70205 WP_000059512.1.70240 WP_000059512.1.70249 WP_000059512.1.70261 WP_000059512.1.70314 WP_000059512.1.7033 WP_000059512.1.70427 WP_000059512.1.70433 WP_000059512.1.70545 WP_000059512.1.70623 WP_000059512.1.70671 WP_000059512.1.70679 WP_000059512.1.70708 WP_000059512.1.70717 WP_000059512.1.70731 WP_000059512.1.70772 WP_000059512.1.70845 WP_000059512.1.70846 WP_000059512.1.70981 WP_000059512.1.70995 WP_000059512.1.71039 WP_000059512.1.71057 WP_000059512.1.71081 WP_000059512.1.71117 WP_000059512.1.71186 WP_000059512.1.71455 WP_000059512.1.71456 WP_000059512.1.71487 WP_000059512.1.71523 WP_000059512.1.71542 WP_000059512.1.71566 WP_000059512.1.71640 WP_000059512.1.71651 WP_000059512.1.71653 WP_000059512.1.71716 WP_000059512.1.71872 WP_000059512.1.71950 WP_000059512.1.71954 WP_000059512.1.71985 WP_000059512.1.72003 WP_000059512.1.72073 WP_000059512.1.72269 WP_000059512.1.72350 WP_000059512.1.72383 WP_000059512.1.72461 WP_000059512.1.72527 WP_000059512.1.7255 WP_000059512.1.72631 WP_000059512.1.72638 WP_000059512.1.72667 WP_000059512.1.72674 WP_000059512.1.72724 WP_000059512.1.72789 WP_000059512.1.72828 WP_000059512.1.72896 WP_000059512.1.72969 WP_000059512.1.72987 WP_000059512.1.73052 WP_000059512.1.7311 WP_000059512.1.73114 WP_000059512.1.73177 WP_000059512.1.73180 WP_000059512.1.73258 WP_000059512.1.73285 WP_000059512.1.7332 WP_000059512.1.7333 WP_000059512.1.73352 WP_000059512.1.73389 WP_000059512.1.73425 WP_000059512.1.73488 WP_000059512.1.73504 WP_000059512.1.7353 WP_000059512.1.73544 WP_000059512.1.73598 WP_000059512.1.7361 WP_000059512.1.73648 WP_000059512.1.73768 WP_000059512.1.73849 WP_000059512.1.73948 WP_000059512.1.73999 WP_000059512.1.74024 WP_000059512.1.74030 WP_000059512.1.74038 WP_000059512.1.74043 WP_000059512.1.74058 WP_000059512.1.74070 WP_000059512.1.74077 WP_000059512.1.74135 WP_000059512.1.74214 WP_000059512.1.74241 WP_000059512.1.74285 WP_000059512.1.7430 WP_000059512.1.74317 WP_000059512.1.74415 WP_000059512.1.74616 WP_000059512.1.74621 WP_000059512.1.74647 WP_000059512.1.74677 WP_000059512.1.74699 WP_000059512.1.74831 WP_000059512.1.74894 WP_000059512.1.74929 WP_000059512.1.74939 WP_000059512.1.74973 WP_000059512.1.7507 WP_000059512.1.75089 WP_000059512.1.75116 WP_000059512.1.75237 WP_000059512.1.75273 WP_000059512.1.75296 WP_000059512.1.75413 WP_000059512.1.75433 WP_000059512.1.75532 WP_000059512.1.75565 WP_000059512.1.75593 WP_000059512.1.75610 WP_000059512.1.75633 WP_000059512.1.75718 WP_000059512.1.75745 WP_000059512.1.75844 WP_000059512.1.75886 WP_000059512.1.75898 WP_000059512.1.76081 WP_000059512.1.76116 WP_000059512.1.76122 WP_000059512.1.76256 WP_000059512.1.76339 WP_000059512.1.76366 WP_000059512.1.76417 WP_000059512.1.7646 WP_000059512.1.76510 WP_000059512.1.76558 WP_000059512.1.76572 WP_000059512.1.76641 WP_000059512.1.76651 WP_000059512.1.76653 WP_000059512.1.76788 WP_000059512.1.76854 WP_000059512.1.76916 WP_000059512.1.76932 WP_000059512.1.76973 WP_000059512.1.76988 WP_000059512.1.77016 WP_000059512.1.77087 WP_000059512.1.77090 WP_000059512.1.77111 WP_000059512.1.77299 WP_000059512.1.77384 WP_000059512.1.77501 WP_000059512.1.77512 WP_000059512.1.77513 WP_000059512.1.77563 WP_000059512.1.77702 WP_000059512.1.77713 WP_000059512.1.7772 WP_000059512.1.77825 WP_000059512.1.77837 WP_000059512.1.77900 WP_000059512.1.77923 WP_000059512.1.77975 WP_000059512.1.78035 WP_000059512.1.78048 WP_000059512.1.78107 WP_000059512.1.78166 WP_000059512.1.78192 WP_000059512.1.78195 WP_000059512.1.78291 WP_000059512.1.78309 WP_000059512.1.78320 WP_000059512.1.78382 WP_000059512.1.78388 WP_000059512.1.78410 WP_000059512.1.7862 WP_000059512.1.78626 WP_000059512.1.78661 WP_000059512.1.78674 WP_000059512.1.78676 WP_000059512.1.78761 WP_000059512.1.789 WP_000059512.1.78993 WP_000059512.1.79012 WP_000059512.1.79069 WP_000059512.1.79074 WP_000059512.1.79098 WP_000059512.1.79155 WP_000059512.1.79164 WP_000059512.1.79204 WP_000059512.1.79280 WP_000059512.1.79397 WP_000059512.1.79456 WP_000059512.1.79532 WP_000059512.1.79547 WP_000059512.1.79654 WP_000059512.1.7970 WP_000059512.1.79722 WP_000059512.1.79772 WP_000059512.1.79880 WP_000059512.1.79916 WP_000059512.1.80065 WP_000059512.1.80103 WP_000059512.1.80273 WP_000059512.1.80282 WP_000059512.1.80354 WP_000059512.1.80368 WP_000059512.1.80386 WP_000059512.1.80400 WP_000059512.1.80462 WP_000059512.1.8049 WP_000059512.1.80492 WP_000059512.1.80569 WP_000059512.1.80664 WP_000059512.1.80696 WP_000059512.1.80984 WP_000059512.1.81131 WP_000059512.1.81187 WP_000059512.1.81262 WP_000059512.1.81268 WP_000059512.1.81269 WP_000059512.1.81271 WP_000059512.1.8131 WP_000059512.1.81333 WP_000059512.1.81342 WP_000059512.1.81364 WP_000059512.1.81494 WP_000059512.1.81557 WP_000059512.1.81676 WP_000059512.1.81681 WP_000059512.1.8170 WP_000059512.1.81763 WP_000059512.1.81855 WP_000059512.1.81921 WP_000059512.1.81931 WP_000059512.1.81936 WP_000059512.1.81949 WP_000059512.1.82070 WP_000059512.1.82076 WP_000059512.1.82131 WP_000059512.1.82156 WP_000059512.1.8218 WP_000059512.1.82180 WP_000059512.1.82201 WP_000059512.1.82214 WP_000059512.1.82225 WP_000059512.1.8240 WP_000059512.1.82408 WP_000059512.1.82416 WP_000059512.1.8242 WP_000059512.1.82456 WP_000059512.1.82465 WP_000059512.1.82473 WP_000059512.1.82553 WP_000059512.1.82646 WP_000059512.1.82670 WP_000059512.1.82731 WP_000059512.1.82812 WP_000059512.1.82850 WP_000059512.1.82872 WP_000059512.1.8294 WP_000059512.1.82959 WP_000059512.1.83007 WP_000059512.1.8304 WP_000059512.1.83180 WP_000059512.1.83229 WP_000059512.1.83235 WP_000059512.1.83290 WP_000059512.1.83333 WP_000059512.1.83657 WP_000059512.1.83677 WP_000059512.1.8375 WP_000059512.1.83923 WP_000059512.1.83994 WP_000059512.1.84 WP_000059512.1.8406 WP_000059512.1.84076 WP_000059512.1.84110 WP_000059512.1.84127 WP_000059512.1.84150 WP_000059512.1.84252 WP_000059512.1.8431 WP_000059512.1.84345 WP_000059512.1.84369 WP_000059512.1.84401 WP_000059512.1.84435 WP_000059512.1.84567 WP_000059512.1.84631 WP_000059512.1.84727 WP_000059512.1.84744 WP_000059512.1.84773 WP_000059512.1.84945 WP_000059512.1.85004 WP_000059512.1.8502 WP_000059512.1.85039 WP_000059512.1.85153 WP_000059512.1.85273 WP_000059512.1.85338 WP_000059512.1.85339 WP_000059512.1.85511 WP_000059512.1.85512 WP_000059512.1.8557 WP_000059512.1.85606 WP_000059512.1.85635 WP_000059512.1.85646 WP_000059512.1.85665 WP_000059512.1.85669 WP_000059512.1.85688 WP_000059512.1.85703 WP_000059512.1.85728 WP_000059512.1.85746 WP_000059512.1.85811 WP_000059512.1.859 WP_000059512.1.85917 WP_000059512.1.8594 WP_000059512.1.85977 WP_000059512.1.860 WP_000059512.1.8605 WP_000059512.1.86084 WP_000059512.1.8610 WP_000059512.1.8614 WP_000059512.1.86156 WP_000059512.1.86323 WP_000059512.1.86342 WP_000059512.1.8640 WP_000059512.1.8642 WP_000059512.1.86426 WP_000059512.1.86489 WP_000059512.1.86530 WP_000059512.1.86663 WP_000059512.1.86770 WP_000059512.1.86794 WP_000059512.1.86800 WP_000059512.1.86811 WP_000059512.1.86815 WP_000059512.1.86945 WP_000059512.1.86989 WP_000059512.1.87023 WP_000059512.1.87034 WP_000059512.1.87041 WP_000059512.1.87136 WP_000059512.1.87155 WP_000059512.1.87258 WP_000059512.1.87293 WP_000059512.1.87420 WP_000059512.1.87528 WP_000059512.1.87560 WP_000059512.1.8760 WP_000059512.1.87600 WP_000059512.1.87609 WP_000059512.1.87612 WP_000059512.1.87615 WP_000059512.1.87653 WP_000059512.1.87659 WP_000059512.1.87698 WP_000059512.1.87706 WP_000059512.1.87739 WP_000059512.1.87741 WP_000059512.1.87742 WP_000059512.1.87852 WP_000059512.1.87949 WP_000059512.1.88025 WP_000059512.1.88026 WP_000059512.1.8805 WP_000059512.1.8806 WP_000059512.1.881 WP_000059512.1.88145 WP_000059512.1.88199 WP_000059512.1.88299 WP_000059512.1.88313 WP_000059512.1.88359 WP_000059512.1.88407 WP_000059512.1.88414 WP_000059512.1.88444 WP_000059512.1.88446 WP_000059512.1.88458 WP_000059512.1.88501 WP_000059512.1.88538 WP_000059512.1.88547 WP_000059512.1.886 WP_000059512.1.88647 WP_000059512.1.88648 WP_000059512.1.88692 WP_000059512.1.88707 WP_000059512.1.88727 WP_000059512.1.88772 WP_000059512.1.88850 WP_000059512.1.8889 WP_000059512.1.88892 WP_000059512.1.88894 WP_000059512.1.89182 WP_000059512.1.89298 WP_000059512.1.89308 WP_000059512.1.89314 WP_000059512.1.89328 WP_000059512.1.89332 WP_000059512.1.89343 WP_000059512.1.89395 WP_000059512.1.8940 WP_000059512.1.89449 WP_000059512.1.8947 WP_000059512.1.89503 WP_000059512.1.89591 WP_000059512.1.89612 WP_000059512.1.89668 WP_000059512.1.89706 WP_000059512.1.89713 WP_000059512.1.89733 WP_000059512.1.89796 WP_000059512.1.89804 WP_000059512.1.89845 WP_000059512.1.89888 WP_000059512.1.89911 WP_000059512.1.8995 WP_000059512.1.89952 WP_000059512.1.90007 WP_000059512.1.9011 WP_000059512.1.90196 WP_000059512.1.90240 WP_000059512.1.90274 WP_000059512.1.90280 WP_000059512.1.90330 WP_000059512.1.90338 WP_000059512.1.90365 WP_000059512.1.90428 WP_000059512.1.90489 WP_000059512.1.90513 WP_000059512.1.90582 WP_000059512.1.90713 WP_000059512.1.90794 WP_000059512.1.90796 WP_000059512.1.90811 WP_000059512.1.9091 WP_000059512.1.91067 WP_000059512.1.91164 WP_000059512.1.91205 WP_000059512.1.91239 WP_000059512.1.91291 WP_000059512.1.91313 WP_000059512.1.9135 WP_000059512.1.91506 WP_000059512.1.91557 WP_000059512.1.91597 WP_000059512.1.91715 WP_000059512.1.9187 WP_000059512.1.91870 WP_000059512.1.92018 WP_000059512.1.92087 WP_000059512.1.92098 WP_000059512.1.92156 WP_000059512.1.92172 WP_000059512.1.92240 WP_000059512.1.92243 WP_000059512.1.92327 WP_000059512.1.92470 WP_000059512.1.92477 WP_000059512.1.92545 WP_000059512.1.92570 WP_000059512.1.92588 WP_000059512.1.926 WP_000059512.1.92633 WP_000059512.1.92649 WP_000059512.1.92676 WP_000059512.1.92705 WP_000059512.1.9271 WP_000059512.1.92734 WP_000059512.1.92810 WP_000059512.1.92823 WP_000059512.1.92987 WP_000059512.1.93007 WP_000059512.1.93022 WP_000059512.1.93103 WP_000059512.1.93105 WP_000059512.1.93111 WP_000059512.1.93121 WP_000059512.1.93168 WP_000059512.1.93184 WP_000059512.1.93221 WP_000059512.1.93223 WP_000059512.1.93239 WP_000059512.1.93302 WP_000059512.1.9336 WP_000059512.1.93387 WP_000059512.1.93469 WP_000059512.1.93511 WP_000059512.1.93512 WP_000059512.1.93635 WP_000059512.1.93657 WP_000059512.1.9374 WP_000059512.1.9375 WP_000059512.1.93754 WP_000059512.1.93780 WP_000059512.1.93828 WP_000059512.1.93842 WP_000059512.1.93843 WP_000059512.1.93875 WP_000059512.1.93909 WP_000059512.1.93919 WP_000059512.1.93938 WP_000059512.1.93984 WP_000059512.1.9399 WP_000059512.1.94017 WP_000059512.1.94079 WP_000059512.1.94097 WP_000059512.1.94107 WP_000059512.1.94142 WP_000059512.1.94215 WP_000059512.1.94303 WP_000059512.1.94365 WP_000059512.1.94390 WP_000059512.1.94415 WP_000059512.1.94492 WP_000059512.1.94510 WP_000059512.1.94527 WP_000059512.1.94573 WP_000059512.1.94579 WP_000059512.1.94586 WP_000059512.1.94593 WP_000059512.1.94650 WP_000059512.1.94659 WP_000059512.1.94662 WP_000059512.1.94700 WP_000059512.1.94745 WP_000059512.1.94782 WP_000059512.1.94815 WP_000059512.1.94820 WP_000059512.1.94850 WP_000059512.1.94851 WP_000059512.1.94864 WP_000059512.1.95006 WP_000059512.1.95055 WP_000059512.1.95076 WP_000059512.1.95099 WP_000059512.1.95165 WP_000059512.1.95239 WP_000059512.1.95246 WP_000059512.1.9525 WP_000059512.1.95255 WP_000059512.1.95265 WP_000059512.1.95338 WP_000059512.1.95412 WP_000059512.1.95530 WP_000059512.1.95547 WP_000059512.1.95590 WP_000059512.1.95625 WP_000059512.1.95675 WP_000059512.1.95716 WP_000059512.1.95776 WP_000059512.1.95884 WP_000059512.1.95890 WP_000059512.1.95906 WP_000059512.1.96025 WP_000059512.1.96044 WP_000059512.1.96054 WP_000059512.1.96094 WP_000059512.1.96127 WP_000059512.1.96144 WP_000059512.1.96188 WP_000059512.1.96211 WP_000059512.1.96212 WP_000059512.1.96319 WP_000059512.1.9633 WP_000059512.1.96359 WP_000059512.1.96539 WP_000059512.1.96552 WP_000059512.1.96610 WP_000059512.1.96625 WP_000059512.1.96635 WP_000059512.1.9664 WP_000059512.1.96675 WP_000059512.1.9670 WP_000059512.1.96750 WP_000059512.1.96792 WP_000059512.1.96801 WP_000059512.1.96803 WP_000059512.1.96925 WP_000059512.1.96938 WP_000059512.1.96946 WP_000059512.1.96957 WP_000059512.1.96978 WP_000059512.1.97026 WP_000059512.1.97028 WP_000059512.1.97079 WP_000059512.1.97154 WP_000059512.1.97184 WP_000059512.1.97287 WP_000059512.1.97291 WP_000059512.1.97422 WP_000059512.1.97441 WP_000059512.1.97497 WP_000059512.1.97505 WP_000059512.1.97599 WP_000059512.1.97606 WP_000059512.1.97615 WP_000059512.1.97646 WP_000059512.1.97690 WP_000059512.1.97819 WP_000059512.1.97840 WP_000059512.1.97938 WP_000059512.1.97986 WP_000059512.1.98036 WP_000059512.1.98080 WP_000059512.1.98086 WP_000059512.1.98158 WP_000059512.1.98263 WP_000059512.1.98418 WP_000059512.1.98448 WP_000059512.1.98457 WP_000059512.1.9850 WP_000059512.1.98502 WP_000059512.1.98607 WP_000059512.1.98731 WP_000059512.1.98762 WP_000059512.1.9877 WP_000059512.1.98801 WP_000059512.1.98818 WP_000059512.1.99163 WP_000059512.1.99335 WP_000059512.1.99350 WP_000059512.1.99360 WP_000059512.1.99363 WP_000059512.1.99369 WP_000059512.1.99388 WP_000059512.1.99397 WP_000059512.1.99463 WP_000059512.1.99483 WP_000059512.1.99546 WP_000059512.1.99579 WP_000059512.1.99595 WP_000059512.1.99671 WP_000059512.1.99676 WP_000059512.1.99764 WP_000059512.1.99829 WP_000059512.1.99837 WP_000059512.1.99841 WP_000059512.1.9992 WP_000059512.1.99996 209261.t1182 220341.STY1811 gi|16760592|ref|NP_456209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]