SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16760857|ref|NP_456474.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16760857|ref|NP_456474.1|
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily CutC-like 5.36e-75
Family CutC-like 0.00000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16760857|ref|NP_456474.1|
Sequence length 259
Comment copper homeostasis protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MALLEICCYSMECALTAQRNGADRIELCAAPKEGGLTPSFGILRSVREHITIPVHPIIRP
RGGDFYYTDGEFAAMLEDIRLVRELGFPGLVTGVLTVDGDVDMSRMEKIMAAAGPLAVTF
HRAFDMCANPFNALKNLADAGVARVLTSGQKADAAQGLSIIMELIAQGDAPIIMAGAGVR
ANNLQNFLDAGVREVHSSAGVLLPSPMRYRNQGLSMSADIQADEYSRYRVEGAAVAENER
NHCSPSGQMIFTVASCRPI
Download sequence
Identical sequences Q8Z5V9
209261.t0970 220341.STY2115 gi|16760857|ref|NP_456474.1| AE014613|CDS_1059750-1060529 AL513382|CDS_1966731-1965952 NP_456474.1.84458 gi|378959127|ref|YP_005216613.1| gi|29141451|ref|NP_804793.1| gi|488653506|ref|YP_007925309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]