SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16761004|ref|NP_456621.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16761004|ref|NP_456621.1|
Domain Number 1 Region: 16-355
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.93e-78
Family AAT-like 0.0000000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16761004|ref|NP_456621.1|
Sequence length 359
Comment histidinol-phosphate aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MSTENTLSVADLARENVRNLVPYQSARRLGGNGDVWLNANEFPTAVEFQLTQQTLNRYPE
CQPKAVIENYAQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSVSA
ETIGVERRTVPALENWQLDLQGISDNLDGAKVVFVCSPNNPTGQLINPQDLRTLLELTRG
KAIVVADEAYIEFCPQATLAGWLVKYPHLVILRTLSKAFALAGLRCGFTLANEEVINLLL
KVIAPYPLSTPVADIAAQALSPQGINVMRDRVAQTVQERQYLVNALQQTACVEHVFDSET
NYILARFTASSSVFKSLWDQGIILRDQNKQPSLSGCLRITVGTRQENQRVIDALRAEPV
Download sequence
Identical sequences Q8Z5J9
209261.t0800 220341.STY2282 gi|29141300|ref|NP_804642.1| gi|488653336|ref|YP_007925139.1| gi|378958950|ref|YP_005216436.1| NP_456621.1.84458 WP_000102709.1.100008 WP_000102709.1.100036 WP_000102709.1.100079 WP_000102709.1.100196 WP_000102709.1.100284 WP_000102709.1.100313 WP_000102709.1.100314 WP_000102709.1.100321 WP_000102709.1.100354 WP_000102709.1.100421 WP_000102709.1.100446 WP_000102709.1.100450 WP_000102709.1.100592 WP_000102709.1.100610 WP_000102709.1.100732 WP_000102709.1.100733 WP_000102709.1.100739 WP_000102709.1.100764 WP_000102709.1.100799 WP_000102709.1.100941 WP_000102709.1.100953 WP_000102709.1.101011 WP_000102709.1.10108 WP_000102709.1.101226 WP_000102709.1.10124 WP_000102709.1.101271 WP_000102709.1.101312 WP_000102709.1.101322 WP_000102709.1.101374 WP_000102709.1.101616 WP_000102709.1.101890 WP_000102709.1.101941 WP_000102709.1.102050 WP_000102709.1.102087 WP_000102709.1.10338 WP_000102709.1.1038 WP_000102709.1.104 WP_000102709.1.10401 WP_000102709.1.10428 WP_000102709.1.10459 WP_000102709.1.10475 WP_000102709.1.10511 WP_000102709.1.10514 WP_000102709.1.10530 WP_000102709.1.10532 WP_000102709.1.10547 WP_000102709.1.10595 WP_000102709.1.10642 WP_000102709.1.10654 WP_000102709.1.10677 WP_000102709.1.10857 WP_000102709.1.10873 WP_000102709.1.10926 WP_000102709.1.10936 WP_000102709.1.11012 WP_000102709.1.11055 WP_000102709.1.11126 WP_000102709.1.11142 WP_000102709.1.11239 WP_000102709.1.11253 WP_000102709.1.11314 WP_000102709.1.11385 WP_000102709.1.1142 WP_000102709.1.11426 WP_000102709.1.11429 WP_000102709.1.11557 WP_000102709.1.11567 WP_000102709.1.11638 WP_000102709.1.11883 WP_000102709.1.11908 WP_000102709.1.11914 WP_000102709.1.12040 WP_000102709.1.12061 WP_000102709.1.1207 WP_000102709.1.12141 WP_000102709.1.12172 WP_000102709.1.12192 WP_000102709.1.1224 WP_000102709.1.12364 WP_000102709.1.12398 WP_000102709.1.12441 WP_000102709.1.12581 WP_000102709.1.12620 WP_000102709.1.12648 WP_000102709.1.12683 WP_000102709.1.12726 WP_000102709.1.12727 WP_000102709.1.12741 WP_000102709.1.12834 WP_000102709.1.13108 WP_000102709.1.13161 WP_000102709.1.1321 WP_000102709.1.13268 WP_000102709.1.13291 WP_000102709.1.133 WP_000102709.1.13314 WP_000102709.1.13338 WP_000102709.1.13342 WP_000102709.1.13352 WP_000102709.1.13406 WP_000102709.1.13440 WP_000102709.1.13443 WP_000102709.1.13476 WP_000102709.1.13599 WP_000102709.1.13686 WP_000102709.1.1372 WP_000102709.1.13732 WP_000102709.1.1382 WP_000102709.1.1397 WP_000102709.1.13972 WP_000102709.1.140 WP_000102709.1.1401 WP_000102709.1.1408 WP_000102709.1.14089 WP_000102709.1.14099 WP_000102709.1.14120 WP_000102709.1.14123 WP_000102709.1.14150 WP_000102709.1.14191 WP_000102709.1.14197 WP_000102709.1.14280 WP_000102709.1.14333 WP_000102709.1.14399 WP_000102709.1.14444 WP_000102709.1.14467 WP_000102709.1.14474 WP_000102709.1.14500 WP_000102709.1.14526 WP_000102709.1.14550 WP_000102709.1.14575 WP_000102709.1.14701 WP_000102709.1.14703 WP_000102709.1.14719 WP_000102709.1.1473 WP_000102709.1.14765 WP_000102709.1.14810 WP_000102709.1.14877 WP_000102709.1.14894 WP_000102709.1.14930 WP_000102709.1.14947 WP_000102709.1.14948 WP_000102709.1.15184 WP_000102709.1.15244 WP_000102709.1.15265 WP_000102709.1.15362 WP_000102709.1.15415 WP_000102709.1.15423 WP_000102709.1.15433 WP_000102709.1.15439 WP_000102709.1.15487 WP_000102709.1.15535 WP_000102709.1.15581 WP_000102709.1.15597 WP_000102709.1.15710 WP_000102709.1.15717 WP_000102709.1.15905 WP_000102709.1.15912 WP_000102709.1.15970 WP_000102709.1.16046 WP_000102709.1.16051 WP_000102709.1.16058 WP_000102709.1.16150 WP_000102709.1.16155 WP_000102709.1.1626 WP_000102709.1.16264 WP_000102709.1.16344 WP_000102709.1.16452 WP_000102709.1.16461 WP_000102709.1.16462 WP_000102709.1.16465 WP_000102709.1.16522 WP_000102709.1.16588 WP_000102709.1.16658 WP_000102709.1.16666 WP_000102709.1.16673 WP_000102709.1.1674 WP_000102709.1.16767 WP_000102709.1.16781 WP_000102709.1.16879 WP_000102709.1.16893 WP_000102709.1.16905 WP_000102709.1.16948 WP_000102709.1.17049 WP_000102709.1.17058 WP_000102709.1.17078 WP_000102709.1.17202 WP_000102709.1.17219 WP_000102709.1.1722 WP_000102709.1.17302 WP_000102709.1.17308 WP_000102709.1.17368 WP_000102709.1.17405 WP_000102709.1.17406 WP_000102709.1.17513 WP_000102709.1.17543 WP_000102709.1.17563 WP_000102709.1.17578 WP_000102709.1.17622 WP_000102709.1.17659 WP_000102709.1.17667 WP_000102709.1.17686 WP_000102709.1.17741 WP_000102709.1.17840 WP_000102709.1.17956 WP_000102709.1.18005 WP_000102709.1.1801 WP_000102709.1.18021 WP_000102709.1.18099 WP_000102709.1.18124 WP_000102709.1.18144 WP_000102709.1.18173 WP_000102709.1.18270 WP_000102709.1.18280 WP_000102709.1.18328 WP_000102709.1.18358 WP_000102709.1.18370 WP_000102709.1.18406 WP_000102709.1.18474 WP_000102709.1.18513 WP_000102709.1.18610 WP_000102709.1.18678 WP_000102709.1.18722 WP_000102709.1.18766 WP_000102709.1.1880 WP_000102709.1.1885 WP_000102709.1.18860 WP_000102709.1.18922 WP_000102709.1.18959 WP_000102709.1.19001 WP_000102709.1.19006 WP_000102709.1.19044 WP_000102709.1.19084 WP_000102709.1.19187 WP_000102709.1.19228 WP_000102709.1.19288 WP_000102709.1.19300 WP_000102709.1.19422 WP_000102709.1.19454 WP_000102709.1.19456 WP_000102709.1.19496 WP_000102709.1.19535 WP_000102709.1.19538 WP_000102709.1.19589 WP_000102709.1.19663 WP_000102709.1.19686 WP_000102709.1.19731 WP_000102709.1.19794 WP_000102709.1.1992 WP_000102709.1.19999 WP_000102709.1.20254 WP_000102709.1.20255 WP_000102709.1.20296 WP_000102709.1.20339 WP_000102709.1.20419 WP_000102709.1.20465 WP_000102709.1.20492 WP_000102709.1.2053 WP_000102709.1.20635 WP_000102709.1.20718 WP_000102709.1.2073 WP_000102709.1.20740 WP_000102709.1.20828 WP_000102709.1.2087 WP_000102709.1.20883 WP_000102709.1.20947 WP_000102709.1.20953 WP_000102709.1.21010 WP_000102709.1.2106 WP_000102709.1.21062 WP_000102709.1.21144 WP_000102709.1.21162 WP_000102709.1.21184 WP_000102709.1.21185 WP_000102709.1.21366 WP_000102709.1.21492 WP_000102709.1.2166 WP_000102709.1.21674 WP_000102709.1.21946 WP_000102709.1.21966 WP_000102709.1.22064 WP_000102709.1.22118 WP_000102709.1.22126 WP_000102709.1.2216 WP_000102709.1.22208 WP_000102709.1.2227 WP_000102709.1.22373 WP_000102709.1.22476 WP_000102709.1.22614 WP_000102709.1.22652 WP_000102709.1.22683 WP_000102709.1.2284 WP_000102709.1.22895 WP_000102709.1.22926 WP_000102709.1.22943 WP_000102709.1.22967 WP_000102709.1.23040 WP_000102709.1.23058 WP_000102709.1.23218 WP_000102709.1.2331 WP_000102709.1.2332 WP_000102709.1.23340 WP_000102709.1.2336 WP_000102709.1.23365 WP_000102709.1.23412 WP_000102709.1.23426 WP_000102709.1.23492 WP_000102709.1.23515 WP_000102709.1.23548 WP_000102709.1.23571 WP_000102709.1.23604 WP_000102709.1.23679 WP_000102709.1.23728 WP_000102709.1.2375 WP_000102709.1.23783 WP_000102709.1.23786 WP_000102709.1.23787 WP_000102709.1.23801 WP_000102709.1.24028 WP_000102709.1.24061 WP_000102709.1.24083 WP_000102709.1.24117 WP_000102709.1.24125 WP_000102709.1.24138 WP_000102709.1.24153 WP_000102709.1.24291 WP_000102709.1.24322 WP_000102709.1.24355 WP_000102709.1.24375 WP_000102709.1.24400 WP_000102709.1.24420 WP_000102709.1.24619 WP_000102709.1.24643 WP_000102709.1.24688 WP_000102709.1.24716 WP_000102709.1.2481 WP_000102709.1.24832 WP_000102709.1.24964 WP_000102709.1.25017 WP_000102709.1.25032 WP_000102709.1.25041 WP_000102709.1.25053 WP_000102709.1.25140 WP_000102709.1.25185 WP_000102709.1.25196 WP_000102709.1.25210 WP_000102709.1.25219 WP_000102709.1.25304 WP_000102709.1.25374 WP_000102709.1.25475 WP_000102709.1.25490 WP_000102709.1.25508 WP_000102709.1.25512 WP_000102709.1.25603 WP_000102709.1.2562 WP_000102709.1.25666 WP_000102709.1.25807 WP_000102709.1.25821 WP_000102709.1.25833 WP_000102709.1.25835 WP_000102709.1.25882 WP_000102709.1.25911 WP_000102709.1.25962 WP_000102709.1.25963 WP_000102709.1.26001 WP_000102709.1.26027 WP_000102709.1.26107 WP_000102709.1.2615 WP_000102709.1.26217 WP_000102709.1.26230 WP_000102709.1.26232 WP_000102709.1.26272 WP_000102709.1.26286 WP_000102709.1.26288 WP_000102709.1.26394 WP_000102709.1.26491 WP_000102709.1.2654 WP_000102709.1.26554 WP_000102709.1.26636 WP_000102709.1.26689 WP_000102709.1.2679 WP_000102709.1.26908 WP_000102709.1.2692 WP_000102709.1.26928 WP_000102709.1.270 WP_000102709.1.27008 WP_000102709.1.27027 WP_000102709.1.27070 WP_000102709.1.27077 WP_000102709.1.27086 WP_000102709.1.27087 WP_000102709.1.27111 WP_000102709.1.27115 WP_000102709.1.2713 WP_000102709.1.2717 WP_000102709.1.27228 WP_000102709.1.27282 WP_000102709.1.27285 WP_000102709.1.27309 WP_000102709.1.27329 WP_000102709.1.27361 WP_000102709.1.27565 WP_000102709.1.27595 WP_000102709.1.27598 WP_000102709.1.27706 WP_000102709.1.27775 WP_000102709.1.27785 WP_000102709.1.27900 WP_000102709.1.27928 WP_000102709.1.27945 WP_000102709.1.28004 WP_000102709.1.2809 WP_000102709.1.28155 WP_000102709.1.28198 WP_000102709.1.2822 WP_000102709.1.28229 WP_000102709.1.28384 WP_000102709.1.28386 WP_000102709.1.28395 WP_000102709.1.284 WP_000102709.1.2845 WP_000102709.1.28479 WP_000102709.1.28627 WP_000102709.1.28692 WP_000102709.1.2873 WP_000102709.1.28917 WP_000102709.1.28962 WP_000102709.1.29023 WP_000102709.1.29042 WP_000102709.1.2905 WP_000102709.1.2907 WP_000102709.1.29081 WP_000102709.1.29089 WP_000102709.1.29153 WP_000102709.1.29203 WP_000102709.1.29237 WP_000102709.1.29248 WP_000102709.1.29288 WP_000102709.1.29389 WP_000102709.1.29439 WP_000102709.1.2946 WP_000102709.1.29462 WP_000102709.1.29563 WP_000102709.1.29727 WP_000102709.1.29743 WP_000102709.1.29782 WP_000102709.1.29833 WP_000102709.1.29851 WP_000102709.1.29865 WP_000102709.1.29886 WP_000102709.1.29919 WP_000102709.1.2994 WP_000102709.1.29964 WP_000102709.1.29983 WP_000102709.1.30009 WP_000102709.1.30013 WP_000102709.1.3002 WP_000102709.1.30034 WP_000102709.1.30049 WP_000102709.1.30058 WP_000102709.1.30172 WP_000102709.1.30185 WP_000102709.1.30354 WP_000102709.1.30357 WP_000102709.1.30362 WP_000102709.1.3042 WP_000102709.1.30421 WP_000102709.1.30440 WP_000102709.1.30448 WP_000102709.1.30517 WP_000102709.1.30542 WP_000102709.1.30544 WP_000102709.1.30556 WP_000102709.1.30572 WP_000102709.1.30585 WP_000102709.1.30618 WP_000102709.1.30664 WP_000102709.1.30688 WP_000102709.1.30806 WP_000102709.1.30967 WP_000102709.1.31046 WP_000102709.1.31066 WP_000102709.1.31078 WP_000102709.1.31139 WP_000102709.1.31145 WP_000102709.1.31182 WP_000102709.1.31205 WP_000102709.1.3121 WP_000102709.1.31223 WP_000102709.1.31303 WP_000102709.1.3131 WP_000102709.1.31352 WP_000102709.1.31389 WP_000102709.1.31413 WP_000102709.1.31446 WP_000102709.1.31533 WP_000102709.1.31799 WP_000102709.1.31836 WP_000102709.1.31951 WP_000102709.1.32041 WP_000102709.1.32042 WP_000102709.1.3207 WP_000102709.1.32189 WP_000102709.1.32202 WP_000102709.1.32263 WP_000102709.1.32293 WP_000102709.1.32299 WP_000102709.1.32422 WP_000102709.1.32425 WP_000102709.1.32458 WP_000102709.1.32460 WP_000102709.1.32529 WP_000102709.1.32563 WP_000102709.1.32578 WP_000102709.1.32617 WP_000102709.1.3270 WP_000102709.1.32725 WP_000102709.1.32838 WP_000102709.1.32848 WP_000102709.1.32868 WP_000102709.1.3290 WP_000102709.1.32940 WP_000102709.1.32941 WP_000102709.1.3296 WP_000102709.1.32966 WP_000102709.1.32985 WP_000102709.1.33037 WP_000102709.1.3305 WP_000102709.1.33051 WP_000102709.1.33065 WP_000102709.1.33122 WP_000102709.1.3315 WP_000102709.1.33208 WP_000102709.1.33214 WP_000102709.1.33247 WP_000102709.1.33280 WP_000102709.1.33283 WP_000102709.1.33313 WP_000102709.1.33339 WP_000102709.1.33382 WP_000102709.1.33490 WP_000102709.1.33501 WP_000102709.1.33529 WP_000102709.1.33689 WP_000102709.1.3370 WP_000102709.1.33730 WP_000102709.1.33741 WP_000102709.1.33840 WP_000102709.1.3392 WP_000102709.1.33926 WP_000102709.1.33957 WP_000102709.1.33969 WP_000102709.1.34001 WP_000102709.1.34059 WP_000102709.1.34118 WP_000102709.1.34211 WP_000102709.1.34214 WP_000102709.1.34234 WP_000102709.1.34284 WP_000102709.1.34376 WP_000102709.1.34382 WP_000102709.1.34484 WP_000102709.1.34517 WP_000102709.1.34530 WP_000102709.1.34665 WP_000102709.1.34694 WP_000102709.1.34751 WP_000102709.1.34808 WP_000102709.1.34824 WP_000102709.1.34834 WP_000102709.1.34932 WP_000102709.1.34962 WP_000102709.1.35001 WP_000102709.1.35040 WP_000102709.1.35074 WP_000102709.1.35175 WP_000102709.1.35240 WP_000102709.1.35274 WP_000102709.1.35532 WP_000102709.1.35560 WP_000102709.1.3557 WP_000102709.1.35628 WP_000102709.1.3570 WP_000102709.1.35712 WP_000102709.1.35713 WP_000102709.1.35736 WP_000102709.1.35791 WP_000102709.1.35795 WP_000102709.1.35870 WP_000102709.1.35916 WP_000102709.1.35938 WP_000102709.1.35966 WP_000102709.1.36000 WP_000102709.1.36034 WP_000102709.1.36036 WP_000102709.1.36069 WP_000102709.1.36291 WP_000102709.1.36298 WP_000102709.1.36308 WP_000102709.1.36323 WP_000102709.1.36343 WP_000102709.1.36460 WP_000102709.1.3649 WP_000102709.1.36495 WP_000102709.1.36526 WP_000102709.1.36567 WP_000102709.1.36579 WP_000102709.1.36617 WP_000102709.1.36618 WP_000102709.1.36643 WP_000102709.1.36663 WP_000102709.1.36701 WP_000102709.1.36725 WP_000102709.1.36779 WP_000102709.1.36798 WP_000102709.1.36802 WP_000102709.1.36821 WP_000102709.1.36853 WP_000102709.1.36950 WP_000102709.1.37014 WP_000102709.1.37133 WP_000102709.1.37176 WP_000102709.1.37199 WP_000102709.1.37200 WP_000102709.1.37258 WP_000102709.1.37303 WP_000102709.1.37513 WP_000102709.1.37584 WP_000102709.1.37590 WP_000102709.1.37593 WP_000102709.1.37600 WP_000102709.1.37613 WP_000102709.1.37659 WP_000102709.1.37662 WP_000102709.1.37675 WP_000102709.1.37691 WP_000102709.1.37761 WP_000102709.1.37775 WP_000102709.1.37777 WP_000102709.1.378 WP_000102709.1.379 WP_000102709.1.37911 WP_000102709.1.37941 WP_000102709.1.37985 WP_000102709.1.38061 WP_000102709.1.38064 WP_000102709.1.38108 WP_000102709.1.3816 WP_000102709.1.38207 WP_000102709.1.38261 WP_000102709.1.38266 WP_000102709.1.38310 WP_000102709.1.3834 WP_000102709.1.38351 WP_000102709.1.3838 WP_000102709.1.38381 WP_000102709.1.38440 WP_000102709.1.38486 WP_000102709.1.38515 WP_000102709.1.38595 WP_000102709.1.3860 WP_000102709.1.38642 WP_000102709.1.38734 WP_000102709.1.38877 WP_000102709.1.38983 WP_000102709.1.38996 WP_000102709.1.39056 WP_000102709.1.3907 WP_000102709.1.39105 WP_000102709.1.3914 WP_000102709.1.39147 WP_000102709.1.39161 WP_000102709.1.39210 WP_000102709.1.39235 WP_000102709.1.3931 WP_000102709.1.39435 WP_000102709.1.39502 WP_000102709.1.39530 WP_000102709.1.39619 WP_000102709.1.39620 WP_000102709.1.39624 WP_000102709.1.39659 WP_000102709.1.39667 WP_000102709.1.39775 WP_000102709.1.39879 WP_000102709.1.39890 WP_000102709.1.39941 WP_000102709.1.39945 WP_000102709.1.39947 WP_000102709.1.40095 WP_000102709.1.40097 WP_000102709.1.401 WP_000102709.1.40160 WP_000102709.1.40167 WP_000102709.1.40279 WP_000102709.1.40361 WP_000102709.1.4042 WP_000102709.1.40467 WP_000102709.1.40496 WP_000102709.1.40517 WP_000102709.1.40698 WP_000102709.1.40750 WP_000102709.1.40763 WP_000102709.1.40854 WP_000102709.1.4089 WP_000102709.1.40924 WP_000102709.1.40932 WP_000102709.1.40946 WP_000102709.1.41004 WP_000102709.1.4106 WP_000102709.1.41070 WP_000102709.1.41074 WP_000102709.1.41075 WP_000102709.1.41097 WP_000102709.1.41132 WP_000102709.1.41176 WP_000102709.1.41251 WP_000102709.1.41258 WP_000102709.1.41305 WP_000102709.1.41321 WP_000102709.1.41333 WP_000102709.1.41335 WP_000102709.1.4136 WP_000102709.1.41415 WP_000102709.1.41459 WP_000102709.1.41498 WP_000102709.1.41519 WP_000102709.1.41524 WP_000102709.1.41631 WP_000102709.1.41658 WP_000102709.1.41659 WP_000102709.1.41716 WP_000102709.1.41746 WP_000102709.1.41824 WP_000102709.1.41825 WP_000102709.1.41836 WP_000102709.1.41894 WP_000102709.1.41919 WP_000102709.1.41929 WP_000102709.1.4194 WP_000102709.1.42069 WP_000102709.1.42081 WP_000102709.1.42090 WP_000102709.1.42111 WP_000102709.1.42187 WP_000102709.1.42200 WP_000102709.1.42219 WP_000102709.1.42257 WP_000102709.1.42261 WP_000102709.1.42349 WP_000102709.1.42364 WP_000102709.1.42371 WP_000102709.1.42379 WP_000102709.1.42391 WP_000102709.1.42399 WP_000102709.1.42539 WP_000102709.1.42603 WP_000102709.1.42650 WP_000102709.1.4267 WP_000102709.1.42701 WP_000102709.1.42805 WP_000102709.1.42815 WP_000102709.1.42859 WP_000102709.1.4298 WP_000102709.1.43008 WP_000102709.1.43016 WP_000102709.1.43019 WP_000102709.1.43065 WP_000102709.1.43068 WP_000102709.1.43069 WP_000102709.1.43128 WP_000102709.1.43141 WP_000102709.1.43157 WP_000102709.1.43161 WP_000102709.1.43190 WP_000102709.1.43198 WP_000102709.1.4326 WP_000102709.1.43290 WP_000102709.1.43292 WP_000102709.1.43307 WP_000102709.1.43513 WP_000102709.1.43633 WP_000102709.1.43637 WP_000102709.1.43651 WP_000102709.1.43722 WP_000102709.1.43801 WP_000102709.1.43812 WP_000102709.1.43878 WP_000102709.1.43888 WP_000102709.1.43919 WP_000102709.1.43974 WP_000102709.1.44049 WP_000102709.1.44101 WP_000102709.1.44160 WP_000102709.1.44180 WP_000102709.1.44196 WP_000102709.1.44248 WP_000102709.1.44262 WP_000102709.1.44268 WP_000102709.1.4427 WP_000102709.1.44296 WP_000102709.1.44343 WP_000102709.1.44351 WP_000102709.1.44360 WP_000102709.1.44416 WP_000102709.1.44431 WP_000102709.1.44437 WP_000102709.1.44546 WP_000102709.1.4468 WP_000102709.1.44762 WP_000102709.1.44815 WP_000102709.1.44828 WP_000102709.1.44879 WP_000102709.1.44917 WP_000102709.1.4501 WP_000102709.1.45072 WP_000102709.1.45093 WP_000102709.1.45136 WP_000102709.1.45241 WP_000102709.1.45435 WP_000102709.1.45523 WP_000102709.1.45596 WP_000102709.1.45648 WP_000102709.1.45829 WP_000102709.1.45871 WP_000102709.1.46030 WP_000102709.1.46077 WP_000102709.1.46169 WP_000102709.1.46225 WP_000102709.1.46241 WP_000102709.1.46307 WP_000102709.1.46355 WP_000102709.1.464 WP_000102709.1.46454 WP_000102709.1.46461 WP_000102709.1.46504 WP_000102709.1.46505 WP_000102709.1.46551 WP_000102709.1.46559 WP_000102709.1.46701 WP_000102709.1.46781 WP_000102709.1.46816 WP_000102709.1.46842 WP_000102709.1.4690 WP_000102709.1.46920 WP_000102709.1.46945 WP_000102709.1.47036 WP_000102709.1.47037 WP_000102709.1.47042 WP_000102709.1.47059 WP_000102709.1.47085 WP_000102709.1.47123 WP_000102709.1.47215 WP_000102709.1.47245 WP_000102709.1.47523 WP_000102709.1.47531 WP_000102709.1.47532 WP_000102709.1.47605 WP_000102709.1.47630 WP_000102709.1.4774 WP_000102709.1.47756 WP_000102709.1.4781 WP_000102709.1.47886 WP_000102709.1.47898 WP_000102709.1.48019 WP_000102709.1.48100 WP_000102709.1.48114 WP_000102709.1.48139 WP_000102709.1.48190 WP_000102709.1.48292 WP_000102709.1.48324 WP_000102709.1.48426 WP_000102709.1.48430 WP_000102709.1.48436 WP_000102709.1.48586 WP_000102709.1.4859 WP_000102709.1.48591 WP_000102709.1.48610 WP_000102709.1.48631 WP_000102709.1.48663 WP_000102709.1.48690 WP_000102709.1.48734 WP_000102709.1.48756 WP_000102709.1.48778 WP_000102709.1.48849 WP_000102709.1.48955 WP_000102709.1.48963 WP_000102709.1.48973 WP_000102709.1.49004 WP_000102709.1.49106 WP_000102709.1.49117 WP_000102709.1.49121 WP_000102709.1.4914 WP_000102709.1.49140 WP_000102709.1.49153 WP_000102709.1.49166 WP_000102709.1.49355 WP_000102709.1.49429 WP_000102709.1.49434 WP_000102709.1.49450 WP_000102709.1.495 WP_000102709.1.49545 WP_000102709.1.49703 WP_000102709.1.49769 WP_000102709.1.49846 WP_000102709.1.4991 WP_000102709.1.49947 WP_000102709.1.49959 WP_000102709.1.49997 WP_000102709.1.50014 WP_000102709.1.50030 WP_000102709.1.50043 WP_000102709.1.50103 WP_000102709.1.50158 WP_000102709.1.50247 WP_000102709.1.50308 WP_000102709.1.50309 WP_000102709.1.50387 WP_000102709.1.50406 WP_000102709.1.50468 WP_000102709.1.5051 WP_000102709.1.50566 WP_000102709.1.50570 WP_000102709.1.50626 WP_000102709.1.50726 WP_000102709.1.50771 WP_000102709.1.50875 WP_000102709.1.50885 WP_000102709.1.509 WP_000102709.1.50929 WP_000102709.1.50970 WP_000102709.1.51040 WP_000102709.1.51048 WP_000102709.1.51100 WP_000102709.1.51134 WP_000102709.1.51227 WP_000102709.1.5127 WP_000102709.1.51305 WP_000102709.1.51315 WP_000102709.1.5136 WP_000102709.1.51474 WP_000102709.1.51519 WP_000102709.1.51598 WP_000102709.1.51644 WP_000102709.1.51724 WP_000102709.1.51734 WP_000102709.1.51838 WP_000102709.1.51863 WP_000102709.1.51935 WP_000102709.1.52057 WP_000102709.1.52129 WP_000102709.1.52191 WP_000102709.1.52202 WP_000102709.1.52209 WP_000102709.1.52339 WP_000102709.1.52469 WP_000102709.1.52571 WP_000102709.1.526 WP_000102709.1.52647 WP_000102709.1.52742 WP_000102709.1.52773 WP_000102709.1.52795 WP_000102709.1.52807 WP_000102709.1.52887 WP_000102709.1.53092 WP_000102709.1.53141 WP_000102709.1.53151 WP_000102709.1.53154 WP_000102709.1.53159 WP_000102709.1.53210 WP_000102709.1.53233 WP_000102709.1.53307 WP_000102709.1.53321 WP_000102709.1.53368 WP_000102709.1.53375 WP_000102709.1.53450 WP_000102709.1.5349 WP_000102709.1.53540 WP_000102709.1.53555 WP_000102709.1.53559 WP_000102709.1.5356 WP_000102709.1.53571 WP_000102709.1.5358 WP_000102709.1.53692 WP_000102709.1.53723 WP_000102709.1.5374 WP_000102709.1.53750 WP_000102709.1.53800 WP_000102709.1.53815 WP_000102709.1.53839 WP_000102709.1.53892 WP_000102709.1.53898 WP_000102709.1.53902 WP_000102709.1.53958 WP_000102709.1.53981 WP_000102709.1.53984 WP_000102709.1.54132 WP_000102709.1.54170 WP_000102709.1.54175 WP_000102709.1.54203 WP_000102709.1.54259 WP_000102709.1.5430 WP_000102709.1.54371 WP_000102709.1.54431 WP_000102709.1.54442 WP_000102709.1.54482 WP_000102709.1.54589 WP_000102709.1.54667 WP_000102709.1.54678 WP_000102709.1.54681 WP_000102709.1.54748 WP_000102709.1.5481 WP_000102709.1.54865 WP_000102709.1.54935 WP_000102709.1.54979 WP_000102709.1.55010 WP_000102709.1.55034 WP_000102709.1.55163 WP_000102709.1.55165 WP_000102709.1.55215 WP_000102709.1.55290 WP_000102709.1.55310 WP_000102709.1.55317 WP_000102709.1.55379 WP_000102709.1.5539 WP_000102709.1.55468 WP_000102709.1.55506 WP_000102709.1.55604 WP_000102709.1.55639 WP_000102709.1.55699 WP_000102709.1.55725 WP_000102709.1.55780 WP_000102709.1.55967 WP_000102709.1.56144 WP_000102709.1.56172 WP_000102709.1.5621 WP_000102709.1.56226 WP_000102709.1.56311 WP_000102709.1.56419 WP_000102709.1.56423 WP_000102709.1.56514 WP_000102709.1.56535 WP_000102709.1.56585 WP_000102709.1.56640 WP_000102709.1.56724 WP_000102709.1.56825 WP_000102709.1.56887 WP_000102709.1.56889 WP_000102709.1.56981 WP_000102709.1.57101 WP_000102709.1.57137 WP_000102709.1.57147 WP_000102709.1.57179 WP_000102709.1.57186 WP_000102709.1.57342 WP_000102709.1.57684 WP_000102709.1.57699 WP_000102709.1.57785 WP_000102709.1.57800 WP_000102709.1.57965 WP_000102709.1.57972 WP_000102709.1.58008 WP_000102709.1.58044 WP_000102709.1.58081 WP_000102709.1.5809 WP_000102709.1.58132 WP_000102709.1.58173 WP_000102709.1.58191 WP_000102709.1.58194 WP_000102709.1.58252 WP_000102709.1.58261 WP_000102709.1.58274 WP_000102709.1.58282 WP_000102709.1.58324 WP_000102709.1.58326 WP_000102709.1.5836 WP_000102709.1.58485 WP_000102709.1.58537 WP_000102709.1.58568 WP_000102709.1.58583 WP_000102709.1.58652 WP_000102709.1.58663 WP_000102709.1.58724 WP_000102709.1.5875 WP_000102709.1.58796 WP_000102709.1.58807 WP_000102709.1.58847 WP_000102709.1.58883 WP_000102709.1.58898 WP_000102709.1.58949 WP_000102709.1.58963 WP_000102709.1.58970 WP_000102709.1.58974 WP_000102709.1.59020 WP_000102709.1.59043 WP_000102709.1.59056 WP_000102709.1.59061 WP_000102709.1.59064 WP_000102709.1.59282 WP_000102709.1.59299 WP_000102709.1.59313 WP_000102709.1.5949 WP_000102709.1.59501 WP_000102709.1.59510 WP_000102709.1.5969 WP_000102709.1.59751 WP_000102709.1.59827 WP_000102709.1.59829 WP_000102709.1.59847 WP_000102709.1.59863 WP_000102709.1.59969 WP_000102709.1.59994 WP_000102709.1.60045 WP_000102709.1.60076 WP_000102709.1.60114 WP_000102709.1.60154 WP_000102709.1.60168 WP_000102709.1.60192 WP_000102709.1.60199 WP_000102709.1.60212 WP_000102709.1.60253 WP_000102709.1.60322 WP_000102709.1.60324 WP_000102709.1.60356 WP_000102709.1.6038 WP_000102709.1.60380 WP_000102709.1.6041 WP_000102709.1.60424 WP_000102709.1.60481 WP_000102709.1.605 WP_000102709.1.6058 WP_000102709.1.60584 WP_000102709.1.6060 WP_000102709.1.60676 WP_000102709.1.60708 WP_000102709.1.60725 WP_000102709.1.60783 WP_000102709.1.60792 WP_000102709.1.60807 WP_000102709.1.60882 WP_000102709.1.60889 WP_000102709.1.60950 WP_000102709.1.6104 WP_000102709.1.61044 WP_000102709.1.61076 WP_000102709.1.61123 WP_000102709.1.61147 WP_000102709.1.61168 WP_000102709.1.61210 WP_000102709.1.61357 WP_000102709.1.61511 WP_000102709.1.61539 WP_000102709.1.61542 WP_000102709.1.61553 WP_000102709.1.61649 WP_000102709.1.61652 WP_000102709.1.61697 WP_000102709.1.61809 WP_000102709.1.61877 WP_000102709.1.61920 WP_000102709.1.62124 WP_000102709.1.62199 WP_000102709.1.62223 WP_000102709.1.62302 WP_000102709.1.62314 WP_000102709.1.62323 WP_000102709.1.62333 WP_000102709.1.62338 WP_000102709.1.62380 WP_000102709.1.62411 WP_000102709.1.62436 WP_000102709.1.62475 WP_000102709.1.62536 WP_000102709.1.62640 WP_000102709.1.62686 WP_000102709.1.62751 WP_000102709.1.62825 WP_000102709.1.62913 WP_000102709.1.62932 WP_000102709.1.62960 WP_000102709.1.63016 WP_000102709.1.63025 WP_000102709.1.63069 WP_000102709.1.63087 WP_000102709.1.63169 WP_000102709.1.63297 WP_000102709.1.63448 WP_000102709.1.63514 WP_000102709.1.63583 WP_000102709.1.63592 WP_000102709.1.63663 WP_000102709.1.63736 WP_000102709.1.63816 WP_000102709.1.63876 WP_000102709.1.6389 WP_000102709.1.63901 WP_000102709.1.63955 WP_000102709.1.63963 WP_000102709.1.64032 WP_000102709.1.64087 WP_000102709.1.6415 WP_000102709.1.64293 WP_000102709.1.64332 WP_000102709.1.64376 WP_000102709.1.644 WP_000102709.1.64471 WP_000102709.1.64501 WP_000102709.1.64538 WP_000102709.1.64632 WP_000102709.1.64648 WP_000102709.1.64654 WP_000102709.1.64662 WP_000102709.1.64663 WP_000102709.1.64709 WP_000102709.1.64710 WP_000102709.1.64744 WP_000102709.1.64763 WP_000102709.1.64817 WP_000102709.1.64847 WP_000102709.1.6487 WP_000102709.1.64891 WP_000102709.1.64974 WP_000102709.1.65054 WP_000102709.1.65075 WP_000102709.1.6514 WP_000102709.1.65172 WP_000102709.1.65191 WP_000102709.1.65200 WP_000102709.1.65211 WP_000102709.1.65218 WP_000102709.1.65226 WP_000102709.1.65249 WP_000102709.1.65266 WP_000102709.1.65395 WP_000102709.1.65459 WP_000102709.1.65463 WP_000102709.1.65487 WP_000102709.1.6549 WP_000102709.1.65499 WP_000102709.1.6554 WP_000102709.1.65650 WP_000102709.1.65697 WP_000102709.1.65699 WP_000102709.1.65737 WP_000102709.1.65755 WP_000102709.1.65812 WP_000102709.1.65846 WP_000102709.1.65863 WP_000102709.1.65985 WP_000102709.1.66021 WP_000102709.1.66031 WP_000102709.1.66052 WP_000102709.1.66064 WP_000102709.1.66109 WP_000102709.1.66145 WP_000102709.1.66183 WP_000102709.1.6620 WP_000102709.1.66216 WP_000102709.1.66234 WP_000102709.1.66273 WP_000102709.1.66324 WP_000102709.1.6634 WP_000102709.1.66361 WP_000102709.1.66480 WP_000102709.1.66506 WP_000102709.1.66665 WP_000102709.1.66681 WP_000102709.1.66684 WP_000102709.1.66755 WP_000102709.1.66759 WP_000102709.1.66801 WP_000102709.1.66860 WP_000102709.1.66953 WP_000102709.1.66955 WP_000102709.1.66981 WP_000102709.1.67024 WP_000102709.1.67042 WP_000102709.1.67101 WP_000102709.1.67143 WP_000102709.1.67201 WP_000102709.1.67211 WP_000102709.1.67237 WP_000102709.1.67336 WP_000102709.1.67339 WP_000102709.1.67387 WP_000102709.1.67394 WP_000102709.1.67397 WP_000102709.1.67403 WP_000102709.1.67430 WP_000102709.1.67442 WP_000102709.1.67539 WP_000102709.1.67556 WP_000102709.1.67576 WP_000102709.1.67604 WP_000102709.1.67619 WP_000102709.1.67625 WP_000102709.1.67627 WP_000102709.1.67641 WP_000102709.1.67657 WP_000102709.1.67673 WP_000102709.1.67700 WP_000102709.1.67718 WP_000102709.1.67729 WP_000102709.1.67774 WP_000102709.1.67820 WP_000102709.1.67910 WP_000102709.1.67954 WP_000102709.1.68 WP_000102709.1.68043 WP_000102709.1.68105 WP_000102709.1.68113 WP_000102709.1.68131 WP_000102709.1.68182 WP_000102709.1.6819 WP_000102709.1.68285 WP_000102709.1.68359 WP_000102709.1.68420 WP_000102709.1.68514 WP_000102709.1.68564 WP_000102709.1.68688 WP_000102709.1.68742 WP_000102709.1.68770 WP_000102709.1.68809 WP_000102709.1.68914 WP_000102709.1.69053 WP_000102709.1.69170 WP_000102709.1.69210 WP_000102709.1.69270 WP_000102709.1.69282 WP_000102709.1.69376 WP_000102709.1.69396 WP_000102709.1.69466 WP_000102709.1.69611 WP_000102709.1.69642 WP_000102709.1.69656 WP_000102709.1.69657 WP_000102709.1.69690 WP_000102709.1.69923 WP_000102709.1.69948 WP_000102709.1.69953 WP_000102709.1.70010 WP_000102709.1.70049 WP_000102709.1.70058 WP_000102709.1.70061 WP_000102709.1.70205 WP_000102709.1.70240 WP_000102709.1.70249 WP_000102709.1.70261 WP_000102709.1.70314 WP_000102709.1.7033 WP_000102709.1.70427 WP_000102709.1.70433 WP_000102709.1.70545 WP_000102709.1.70623 WP_000102709.1.70671 WP_000102709.1.70679 WP_000102709.1.70708 WP_000102709.1.70717 WP_000102709.1.70731 WP_000102709.1.70772 WP_000102709.1.70845 WP_000102709.1.70846 WP_000102709.1.70981 WP_000102709.1.70995 WP_000102709.1.71039 WP_000102709.1.71057 WP_000102709.1.71081 WP_000102709.1.71117 WP_000102709.1.71186 WP_000102709.1.71455 WP_000102709.1.71456 WP_000102709.1.71487 WP_000102709.1.71523 WP_000102709.1.71542 WP_000102709.1.71566 WP_000102709.1.71640 WP_000102709.1.71651 WP_000102709.1.71653 WP_000102709.1.71716 WP_000102709.1.71872 WP_000102709.1.71950 WP_000102709.1.71954 WP_000102709.1.71985 WP_000102709.1.72003 WP_000102709.1.72073 WP_000102709.1.72269 WP_000102709.1.72350 WP_000102709.1.72383 WP_000102709.1.72461 WP_000102709.1.72527 WP_000102709.1.7255 WP_000102709.1.72631 WP_000102709.1.72638 WP_000102709.1.72667 WP_000102709.1.72674 WP_000102709.1.72724 WP_000102709.1.72789 WP_000102709.1.72828 WP_000102709.1.72896 WP_000102709.1.72969 WP_000102709.1.72987 WP_000102709.1.73052 WP_000102709.1.7311 WP_000102709.1.73114 WP_000102709.1.73177 WP_000102709.1.73180 WP_000102709.1.73258 WP_000102709.1.73285 WP_000102709.1.7332 WP_000102709.1.7333 WP_000102709.1.73352 WP_000102709.1.73389 WP_000102709.1.73425 WP_000102709.1.73488 WP_000102709.1.73504 WP_000102709.1.7353 WP_000102709.1.73544 WP_000102709.1.73598 WP_000102709.1.7361 WP_000102709.1.73648 WP_000102709.1.73768 WP_000102709.1.73849 WP_000102709.1.73948 WP_000102709.1.73999 WP_000102709.1.74024 WP_000102709.1.74030 WP_000102709.1.74038 WP_000102709.1.74043 WP_000102709.1.74058 WP_000102709.1.74070 WP_000102709.1.74077 WP_000102709.1.74135 WP_000102709.1.74214 WP_000102709.1.74241 WP_000102709.1.74285 WP_000102709.1.7430 WP_000102709.1.74317 WP_000102709.1.74415 WP_000102709.1.74616 WP_000102709.1.74621 WP_000102709.1.74647 WP_000102709.1.74677 WP_000102709.1.74699 WP_000102709.1.74831 WP_000102709.1.74894 WP_000102709.1.74929 WP_000102709.1.74939 WP_000102709.1.74973 WP_000102709.1.7507 WP_000102709.1.75089 WP_000102709.1.75116 WP_000102709.1.75237 WP_000102709.1.75273 WP_000102709.1.75296 WP_000102709.1.75413 WP_000102709.1.75433 WP_000102709.1.75532 WP_000102709.1.75565 WP_000102709.1.75593 WP_000102709.1.75610 WP_000102709.1.75633 WP_000102709.1.75718 WP_000102709.1.75745 WP_000102709.1.75844 WP_000102709.1.75886 WP_000102709.1.75898 WP_000102709.1.76081 WP_000102709.1.76116 WP_000102709.1.76122 WP_000102709.1.76256 WP_000102709.1.76339 WP_000102709.1.76366 WP_000102709.1.76417 WP_000102709.1.7646 WP_000102709.1.76510 WP_000102709.1.76558 WP_000102709.1.76572 WP_000102709.1.76641 WP_000102709.1.76651 WP_000102709.1.76653 WP_000102709.1.76788 WP_000102709.1.76854 WP_000102709.1.76916 WP_000102709.1.76932 WP_000102709.1.76973 WP_000102709.1.76988 WP_000102709.1.77016 WP_000102709.1.77087 WP_000102709.1.77090 WP_000102709.1.77111 WP_000102709.1.77299 WP_000102709.1.77384 WP_000102709.1.77501 WP_000102709.1.77512 WP_000102709.1.77513 WP_000102709.1.77563 WP_000102709.1.77702 WP_000102709.1.77713 WP_000102709.1.7772 WP_000102709.1.77825 WP_000102709.1.77837 WP_000102709.1.77900 WP_000102709.1.77923 WP_000102709.1.77975 WP_000102709.1.78035 WP_000102709.1.78048 WP_000102709.1.78107 WP_000102709.1.78166 WP_000102709.1.78192 WP_000102709.1.78195 WP_000102709.1.78291 WP_000102709.1.78309 WP_000102709.1.78320 WP_000102709.1.78382 WP_000102709.1.78388 WP_000102709.1.78410 WP_000102709.1.7862 WP_000102709.1.78626 WP_000102709.1.78661 WP_000102709.1.78674 WP_000102709.1.78676 WP_000102709.1.78761 WP_000102709.1.789 WP_000102709.1.78993 WP_000102709.1.79012 WP_000102709.1.79069 WP_000102709.1.79074 WP_000102709.1.79098 WP_000102709.1.79155 WP_000102709.1.79164 WP_000102709.1.79204 WP_000102709.1.79280 WP_000102709.1.79397 WP_000102709.1.79456 WP_000102709.1.79532 WP_000102709.1.79547 WP_000102709.1.79654 WP_000102709.1.7970 WP_000102709.1.79722 WP_000102709.1.79772 WP_000102709.1.79880 WP_000102709.1.79916 WP_000102709.1.80065 WP_000102709.1.80103 WP_000102709.1.80273 WP_000102709.1.80282 WP_000102709.1.80354 WP_000102709.1.80368 WP_000102709.1.80386 WP_000102709.1.80400 WP_000102709.1.80462 WP_000102709.1.8049 WP_000102709.1.80492 WP_000102709.1.80569 WP_000102709.1.80664 WP_000102709.1.80696 WP_000102709.1.80984 WP_000102709.1.81131 WP_000102709.1.81187 WP_000102709.1.81262 WP_000102709.1.81268 WP_000102709.1.81269 WP_000102709.1.81271 WP_000102709.1.8131 WP_000102709.1.81333 WP_000102709.1.81342 WP_000102709.1.81364 WP_000102709.1.81494 WP_000102709.1.81557 WP_000102709.1.81676 WP_000102709.1.81681 WP_000102709.1.8170 WP_000102709.1.81763 WP_000102709.1.81855 WP_000102709.1.81921 WP_000102709.1.81931 WP_000102709.1.81936 WP_000102709.1.81949 WP_000102709.1.82070 WP_000102709.1.82076 WP_000102709.1.82131 WP_000102709.1.82156 WP_000102709.1.8218 WP_000102709.1.82180 WP_000102709.1.82201 WP_000102709.1.82214 WP_000102709.1.82225 WP_000102709.1.8240 WP_000102709.1.82408 WP_000102709.1.82416 WP_000102709.1.8242 WP_000102709.1.82456 WP_000102709.1.82465 WP_000102709.1.82473 WP_000102709.1.82553 WP_000102709.1.82646 WP_000102709.1.82670 WP_000102709.1.82731 WP_000102709.1.82812 WP_000102709.1.82850 WP_000102709.1.82872 WP_000102709.1.8294 WP_000102709.1.82959 WP_000102709.1.83007 WP_000102709.1.8304 WP_000102709.1.83180 WP_000102709.1.83229 WP_000102709.1.83235 WP_000102709.1.83290 WP_000102709.1.83333 WP_000102709.1.83657 WP_000102709.1.83677 WP_000102709.1.8375 WP_000102709.1.83923 WP_000102709.1.83994 WP_000102709.1.84 WP_000102709.1.8406 WP_000102709.1.84076 WP_000102709.1.84110 WP_000102709.1.84127 WP_000102709.1.84150 WP_000102709.1.84230 WP_000102709.1.84252 WP_000102709.1.8431 WP_000102709.1.84345 WP_000102709.1.84369 WP_000102709.1.84401 WP_000102709.1.84435 WP_000102709.1.84567 WP_000102709.1.84631 WP_000102709.1.84727 WP_000102709.1.84744 WP_000102709.1.84773 WP_000102709.1.84945 WP_000102709.1.84967 WP_000102709.1.85004 WP_000102709.1.8502 WP_000102709.1.85039 WP_000102709.1.85153 WP_000102709.1.85273 WP_000102709.1.85338 WP_000102709.1.85339 WP_000102709.1.85511 WP_000102709.1.85512 WP_000102709.1.8557 WP_000102709.1.85606 WP_000102709.1.85635 WP_000102709.1.85646 WP_000102709.1.85665 WP_000102709.1.85669 WP_000102709.1.85688 WP_000102709.1.85703 WP_000102709.1.85728 WP_000102709.1.85746 WP_000102709.1.85811 WP_000102709.1.859 WP_000102709.1.85917 WP_000102709.1.8594 WP_000102709.1.85977 WP_000102709.1.860 WP_000102709.1.8605 WP_000102709.1.86084 WP_000102709.1.8610 WP_000102709.1.8614 WP_000102709.1.86156 WP_000102709.1.86323 WP_000102709.1.86342 WP_000102709.1.8640 WP_000102709.1.8642 WP_000102709.1.86426 WP_000102709.1.86489 WP_000102709.1.86530 WP_000102709.1.86663 WP_000102709.1.86770 WP_000102709.1.86794 WP_000102709.1.86800 WP_000102709.1.86811 WP_000102709.1.86815 WP_000102709.1.86945 WP_000102709.1.86989 WP_000102709.1.87023 WP_000102709.1.87034 WP_000102709.1.87041 WP_000102709.1.87136 WP_000102709.1.87155 WP_000102709.1.87258 WP_000102709.1.87293 WP_000102709.1.87420 WP_000102709.1.87528 WP_000102709.1.87560 WP_000102709.1.8760 WP_000102709.1.87600 WP_000102709.1.87609 WP_000102709.1.87612 WP_000102709.1.87615 WP_000102709.1.87653 WP_000102709.1.87659 WP_000102709.1.87698 WP_000102709.1.87706 WP_000102709.1.87739 WP_000102709.1.87741 WP_000102709.1.87742 WP_000102709.1.87852 WP_000102709.1.87949 WP_000102709.1.88025 WP_000102709.1.88026 WP_000102709.1.8805 WP_000102709.1.8806 WP_000102709.1.881 WP_000102709.1.88145 WP_000102709.1.88199 WP_000102709.1.88299 WP_000102709.1.88313 WP_000102709.1.88359 WP_000102709.1.88407 WP_000102709.1.88414 WP_000102709.1.88444 WP_000102709.1.88446 WP_000102709.1.88458 WP_000102709.1.88501 WP_000102709.1.88538 WP_000102709.1.88547 WP_000102709.1.886 WP_000102709.1.88647 WP_000102709.1.88648 WP_000102709.1.88692 WP_000102709.1.88707 WP_000102709.1.88727 WP_000102709.1.88772 WP_000102709.1.88850 WP_000102709.1.8889 WP_000102709.1.88892 WP_000102709.1.88894 WP_000102709.1.89182 WP_000102709.1.89298 WP_000102709.1.89308 WP_000102709.1.89314 WP_000102709.1.89328 WP_000102709.1.89332 WP_000102709.1.89343 WP_000102709.1.89395 WP_000102709.1.8940 WP_000102709.1.89449 WP_000102709.1.8947 WP_000102709.1.89503 WP_000102709.1.89591 WP_000102709.1.89612 WP_000102709.1.89668 WP_000102709.1.89706 WP_000102709.1.89713 WP_000102709.1.89733 WP_000102709.1.89796 WP_000102709.1.89804 WP_000102709.1.89845 WP_000102709.1.89888 WP_000102709.1.89911 WP_000102709.1.8995 WP_000102709.1.89952 WP_000102709.1.90007 WP_000102709.1.9011 WP_000102709.1.90196 WP_000102709.1.90240 WP_000102709.1.90274 WP_000102709.1.90280 WP_000102709.1.90330 WP_000102709.1.90338 WP_000102709.1.90365 WP_000102709.1.90428 WP_000102709.1.90489 WP_000102709.1.90513 WP_000102709.1.90582 WP_000102709.1.90713 WP_000102709.1.90794 WP_000102709.1.90796 WP_000102709.1.90811 WP_000102709.1.9091 WP_000102709.1.91067 WP_000102709.1.91164 WP_000102709.1.91205 WP_000102709.1.91239 WP_000102709.1.91291 WP_000102709.1.91313 WP_000102709.1.9135 WP_000102709.1.91506 WP_000102709.1.91557 WP_000102709.1.91597 WP_000102709.1.91715 WP_000102709.1.9187 WP_000102709.1.91870 WP_000102709.1.92018 WP_000102709.1.92087 WP_000102709.1.92098 WP_000102709.1.92156 WP_000102709.1.92172 WP_000102709.1.92240 WP_000102709.1.92243 WP_000102709.1.92327 WP_000102709.1.92470 WP_000102709.1.92477 WP_000102709.1.92545 WP_000102709.1.92570 WP_000102709.1.92588 WP_000102709.1.926 WP_000102709.1.92633 WP_000102709.1.92649 WP_000102709.1.92676 WP_000102709.1.92705 WP_000102709.1.9271 WP_000102709.1.92734 WP_000102709.1.92810 WP_000102709.1.92823 WP_000102709.1.92987 WP_000102709.1.93007 WP_000102709.1.93022 WP_000102709.1.93103 WP_000102709.1.93105 WP_000102709.1.93111 WP_000102709.1.93121 WP_000102709.1.93168 WP_000102709.1.93184 WP_000102709.1.93221 WP_000102709.1.93223 WP_000102709.1.93239 WP_000102709.1.93302 WP_000102709.1.9336 WP_000102709.1.93387 WP_000102709.1.93469 WP_000102709.1.93511 WP_000102709.1.93512 WP_000102709.1.93635 WP_000102709.1.93657 WP_000102709.1.9374 WP_000102709.1.9375 WP_000102709.1.93754 WP_000102709.1.93780 WP_000102709.1.93828 WP_000102709.1.93842 WP_000102709.1.93843 WP_000102709.1.93875 WP_000102709.1.93909 WP_000102709.1.93919 WP_000102709.1.93938 WP_000102709.1.93984 WP_000102709.1.9399 WP_000102709.1.94017 WP_000102709.1.94079 WP_000102709.1.94097 WP_000102709.1.94107 WP_000102709.1.94142 WP_000102709.1.94215 WP_000102709.1.94303 WP_000102709.1.94365 WP_000102709.1.94390 WP_000102709.1.94415 WP_000102709.1.94492 WP_000102709.1.94510 WP_000102709.1.94527 WP_000102709.1.94573 WP_000102709.1.94579 WP_000102709.1.94586 WP_000102709.1.94593 WP_000102709.1.94650 WP_000102709.1.94659 WP_000102709.1.94662 WP_000102709.1.94700 WP_000102709.1.94745 WP_000102709.1.94782 WP_000102709.1.94815 WP_000102709.1.94820 WP_000102709.1.94850 WP_000102709.1.94851 WP_000102709.1.94864 WP_000102709.1.94952 WP_000102709.1.95006 WP_000102709.1.95055 WP_000102709.1.95076 WP_000102709.1.95099 WP_000102709.1.95165 WP_000102709.1.95239 WP_000102709.1.95246 WP_000102709.1.9525 WP_000102709.1.95255 WP_000102709.1.95265 WP_000102709.1.95338 WP_000102709.1.95412 WP_000102709.1.95530 WP_000102709.1.95547 WP_000102709.1.95590 WP_000102709.1.95625 WP_000102709.1.95675 WP_000102709.1.95716 WP_000102709.1.95776 WP_000102709.1.95884 WP_000102709.1.95890 WP_000102709.1.95906 WP_000102709.1.96025 WP_000102709.1.96044 WP_000102709.1.96054 WP_000102709.1.96094 WP_000102709.1.96127 WP_000102709.1.96144 WP_000102709.1.96188 WP_000102709.1.96211 WP_000102709.1.96212 WP_000102709.1.96319 WP_000102709.1.9633 WP_000102709.1.96359 WP_000102709.1.96539 WP_000102709.1.96552 WP_000102709.1.96610 WP_000102709.1.96625 WP_000102709.1.96635 WP_000102709.1.9664 WP_000102709.1.96675 WP_000102709.1.9670 WP_000102709.1.96750 WP_000102709.1.96792 WP_000102709.1.96801 WP_000102709.1.96803 WP_000102709.1.96925 WP_000102709.1.96938 WP_000102709.1.96946 WP_000102709.1.96957 WP_000102709.1.96978 WP_000102709.1.97026 WP_000102709.1.97028 WP_000102709.1.97079 WP_000102709.1.97154 WP_000102709.1.97184 WP_000102709.1.97287 WP_000102709.1.97291 WP_000102709.1.97422 WP_000102709.1.97441 WP_000102709.1.97497 WP_000102709.1.97505 WP_000102709.1.97599 WP_000102709.1.97606 WP_000102709.1.97615 WP_000102709.1.97646 WP_000102709.1.97690 WP_000102709.1.97819 WP_000102709.1.97840 WP_000102709.1.97938 WP_000102709.1.97986 WP_000102709.1.98036 WP_000102709.1.98080 WP_000102709.1.98086 WP_000102709.1.98158 WP_000102709.1.98263 WP_000102709.1.98418 WP_000102709.1.98448 WP_000102709.1.98457 WP_000102709.1.9850 WP_000102709.1.98502 WP_000102709.1.98607 WP_000102709.1.98731 WP_000102709.1.98762 WP_000102709.1.9877 WP_000102709.1.98801 WP_000102709.1.98818 WP_000102709.1.99163 WP_000102709.1.99335 WP_000102709.1.99350 WP_000102709.1.99360 WP_000102709.1.99363 WP_000102709.1.99369 WP_000102709.1.99388 WP_000102709.1.99397 WP_000102709.1.99463 WP_000102709.1.99483 WP_000102709.1.99546 WP_000102709.1.99579 WP_000102709.1.99595 WP_000102709.1.99671 WP_000102709.1.99676 WP_000102709.1.99764 WP_000102709.1.99829 WP_000102709.1.99837 WP_000102709.1.99841 WP_000102709.1.9992 WP_000102709.1.99996 AE014613|CDS_895229-894150 AL513382|CDS_2108699-2109778 gi|16761004|ref|NP_456621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]