SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16761022|ref|NP_456639.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16761022|ref|NP_456639.1|
Domain Number 1 Region: 37-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.26e-105
Family GABA-aminotransferase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16761022|ref|NP_456639.1|
Sequence length 437
Comment dehydratase RfbH [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MTANNLREQISQLVAQYANEALSPKPFVAGASVVPPSGKVIGAKELQLMVEASLDGWLTT
GRFNDAFEKKLGEFIGVPHVLTTTSGSSANLLALTALTSPKLGERALKPGDEVITVAAGF
PTTVNPAIQNGLIPVFVDVDIPTYNIDASLIEAAVTEKSKAIMIAHTLGNAFNLSEVRRI
ADKYNLWLIEDCCDALGTTYEGRMVGTFGDIGTVSFYPAHHITMGEGGAVFTKSGELKKI
IESFRDWGRDCYCAPGCDNTCGKRFGQQLGSLPQGYDHKYTYSHLGYNLKITDMQAACGL
AQLERVEEFVEQRKANFSYLKQGLQSCTEFLELPEATEKSDPSWFGFPITLKETSGVNRV
ELVKFLDEAKIGTRLLFAGNLIRQPYFANVKYRVVGELTNTDRIMNQTFWIGIYPGLTTE
HLDYVVSKFEEFFGLNF
Download sequence
Identical sequences A0A0H2WMX9 A0A2J1A1T0 Q8Z5I6
209261.t0782 220341.STY2300 295319.SPA0776 554290.SSPA0730 gi|29141282|ref|NP_804624.1| gi|378958932|ref|YP_005216418.1| gi|197361934|ref|YP_002141571.1| AE014613|CDS_873701-875014 AL513382|CDS_2130227-2128914 CP000026|CDS_866405-867718 FM200053|CDS_866350-867663 NP_456639.1.84458 WP_000126347.1.100008 WP_000126347.1.100036 WP_000126347.1.100079 WP_000126347.1.100196 WP_000126347.1.100284 WP_000126347.1.100313 WP_000126347.1.100314 WP_000126347.1.100321 WP_000126347.1.100354 WP_000126347.1.100421 WP_000126347.1.100446 WP_000126347.1.100450 WP_000126347.1.100592 WP_000126347.1.100610 WP_000126347.1.100732 WP_000126347.1.100733 WP_000126347.1.100739 WP_000126347.1.100764 WP_000126347.1.100799 WP_000126347.1.100941 WP_000126347.1.100953 WP_000126347.1.101011 WP_000126347.1.10108 WP_000126347.1.101111 WP_000126347.1.101226 WP_000126347.1.101239 WP_000126347.1.10124 WP_000126347.1.101271 WP_000126347.1.101312 WP_000126347.1.101322 WP_000126347.1.101374 WP_000126347.1.101616 WP_000126347.1.101890 WP_000126347.1.101904 WP_000126347.1.101941 WP_000126347.1.102050 WP_000126347.1.102087 WP_000126347.1.10338 WP_000126347.1.1038 WP_000126347.1.104 WP_000126347.1.10401 WP_000126347.1.10428 WP_000126347.1.10459 WP_000126347.1.10475 WP_000126347.1.10511 WP_000126347.1.10514 WP_000126347.1.10530 WP_000126347.1.10532 WP_000126347.1.10547 WP_000126347.1.10595 WP_000126347.1.10642 WP_000126347.1.10654 WP_000126347.1.10677 WP_000126347.1.10857 WP_000126347.1.10873 WP_000126347.1.10926 WP_000126347.1.10936 WP_000126347.1.11012 WP_000126347.1.11055 WP_000126347.1.11126 WP_000126347.1.11142 WP_000126347.1.11239 WP_000126347.1.11253 WP_000126347.1.11314 WP_000126347.1.11385 WP_000126347.1.1142 WP_000126347.1.11426 WP_000126347.1.11429 WP_000126347.1.11557 WP_000126347.1.11567 WP_000126347.1.11638 WP_000126347.1.11810 WP_000126347.1.11883 WP_000126347.1.11908 WP_000126347.1.11914 WP_000126347.1.12040 WP_000126347.1.12061 WP_000126347.1.1207 WP_000126347.1.12141 WP_000126347.1.12172 WP_000126347.1.12192 WP_000126347.1.12210 WP_000126347.1.1224 WP_000126347.1.12308 WP_000126347.1.12364 WP_000126347.1.12398 WP_000126347.1.12441 WP_000126347.1.12581 WP_000126347.1.12620 WP_000126347.1.12648 WP_000126347.1.12683 WP_000126347.1.12726 WP_000126347.1.12727 WP_000126347.1.12741 WP_000126347.1.12834 WP_000126347.1.12865 WP_000126347.1.13108 WP_000126347.1.13161 WP_000126347.1.1321 WP_000126347.1.13262 WP_000126347.1.13268 WP_000126347.1.13291 WP_000126347.1.133 WP_000126347.1.13314 WP_000126347.1.13338 WP_000126347.1.13342 WP_000126347.1.13352 WP_000126347.1.13406 WP_000126347.1.13440 WP_000126347.1.13443 WP_000126347.1.13476 WP_000126347.1.13599 WP_000126347.1.13602 WP_000126347.1.13686 WP_000126347.1.1372 WP_000126347.1.13732 WP_000126347.1.1382 WP_000126347.1.13967 WP_000126347.1.1397 WP_000126347.1.13972 WP_000126347.1.140 WP_000126347.1.1401 WP_000126347.1.1408 WP_000126347.1.14089 WP_000126347.1.14099 WP_000126347.1.14120 WP_000126347.1.14123 WP_000126347.1.14150 WP_000126347.1.14191 WP_000126347.1.14197 WP_000126347.1.14280 WP_000126347.1.14333 WP_000126347.1.14399 WP_000126347.1.14444 WP_000126347.1.14467 WP_000126347.1.14474 WP_000126347.1.14500 WP_000126347.1.14526 WP_000126347.1.14550 WP_000126347.1.14575 WP_000126347.1.14701 WP_000126347.1.14703 WP_000126347.1.14719 WP_000126347.1.1473 WP_000126347.1.14765 WP_000126347.1.14810 WP_000126347.1.14877 WP_000126347.1.14894 WP_000126347.1.14930 WP_000126347.1.14947 WP_000126347.1.14948 WP_000126347.1.15011 WP_000126347.1.15184 WP_000126347.1.15244 WP_000126347.1.15265 WP_000126347.1.15362 WP_000126347.1.15415 WP_000126347.1.15423 WP_000126347.1.15433 WP_000126347.1.15439 WP_000126347.1.15487 WP_000126347.1.15535 WP_000126347.1.15581 WP_000126347.1.15597 WP_000126347.1.15710 WP_000126347.1.15717 WP_000126347.1.15905 WP_000126347.1.15912 WP_000126347.1.15938 WP_000126347.1.15970 WP_000126347.1.16046 WP_000126347.1.16051 WP_000126347.1.16058 WP_000126347.1.16150 WP_000126347.1.16155 WP_000126347.1.1626 WP_000126347.1.16264 WP_000126347.1.16344 WP_000126347.1.16452 WP_000126347.1.16461 WP_000126347.1.16462 WP_000126347.1.16465 WP_000126347.1.16522 WP_000126347.1.16588 WP_000126347.1.16658 WP_000126347.1.16666 WP_000126347.1.16673 WP_000126347.1.16710 WP_000126347.1.1674 WP_000126347.1.16767 WP_000126347.1.16781 WP_000126347.1.16879 WP_000126347.1.16893 WP_000126347.1.16905 WP_000126347.1.16948 WP_000126347.1.17049 WP_000126347.1.17058 WP_000126347.1.17078 WP_000126347.1.17202 WP_000126347.1.17219 WP_000126347.1.1722 WP_000126347.1.17302 WP_000126347.1.17308 WP_000126347.1.17368 WP_000126347.1.17405 WP_000126347.1.17406 WP_000126347.1.17513 WP_000126347.1.17543 WP_000126347.1.17563 WP_000126347.1.17578 WP_000126347.1.17622 WP_000126347.1.17659 WP_000126347.1.17667 WP_000126347.1.17686 WP_000126347.1.17741 WP_000126347.1.17840 WP_000126347.1.17956 WP_000126347.1.18005 WP_000126347.1.1801 WP_000126347.1.18021 WP_000126347.1.18099 WP_000126347.1.18124 WP_000126347.1.18144 WP_000126347.1.18173 WP_000126347.1.18270 WP_000126347.1.18280 WP_000126347.1.18328 WP_000126347.1.18355 WP_000126347.1.18358 WP_000126347.1.18370 WP_000126347.1.18406 WP_000126347.1.18474 WP_000126347.1.18513 WP_000126347.1.18610 WP_000126347.1.18678 WP_000126347.1.18722 WP_000126347.1.18766 WP_000126347.1.1880 WP_000126347.1.1885 WP_000126347.1.18860 WP_000126347.1.18922 WP_000126347.1.18959 WP_000126347.1.19001 WP_000126347.1.19006 WP_000126347.1.19044 WP_000126347.1.19084 WP_000126347.1.19187 WP_000126347.1.19228 WP_000126347.1.19288 WP_000126347.1.19300 WP_000126347.1.19422 WP_000126347.1.19454 WP_000126347.1.19456 WP_000126347.1.19496 WP_000126347.1.19535 WP_000126347.1.19538 WP_000126347.1.19589 WP_000126347.1.19663 WP_000126347.1.19686 WP_000126347.1.19731 WP_000126347.1.19794 WP_000126347.1.19882 WP_000126347.1.1992 WP_000126347.1.19999 WP_000126347.1.20254 WP_000126347.1.20255 WP_000126347.1.20296 WP_000126347.1.20339 WP_000126347.1.20419 WP_000126347.1.20465 WP_000126347.1.20492 WP_000126347.1.2053 WP_000126347.1.20564 WP_000126347.1.20635 WP_000126347.1.20718 WP_000126347.1.2073 WP_000126347.1.20740 WP_000126347.1.20828 WP_000126347.1.2087 WP_000126347.1.20883 WP_000126347.1.20947 WP_000126347.1.20953 WP_000126347.1.21010 WP_000126347.1.2106 WP_000126347.1.21062 WP_000126347.1.21144 WP_000126347.1.21162 WP_000126347.1.21184 WP_000126347.1.21185 WP_000126347.1.21366 WP_000126347.1.2139 WP_000126347.1.21492 WP_000126347.1.21534 WP_000126347.1.2166 WP_000126347.1.21674 WP_000126347.1.21946 WP_000126347.1.21966 WP_000126347.1.22064 WP_000126347.1.22118 WP_000126347.1.22126 WP_000126347.1.2216 WP_000126347.1.22208 WP_000126347.1.2227 WP_000126347.1.22373 WP_000126347.1.22451 WP_000126347.1.22476 WP_000126347.1.22566 WP_000126347.1.22614 WP_000126347.1.22652 WP_000126347.1.22683 WP_000126347.1.2284 WP_000126347.1.22895 WP_000126347.1.22926 WP_000126347.1.22943 WP_000126347.1.22967 WP_000126347.1.23040 WP_000126347.1.23058 WP_000126347.1.23218 WP_000126347.1.2331 WP_000126347.1.2332 WP_000126347.1.23340 WP_000126347.1.2336 WP_000126347.1.23365 WP_000126347.1.23412 WP_000126347.1.23426 WP_000126347.1.23492 WP_000126347.1.23515 WP_000126347.1.23548 WP_000126347.1.23571 WP_000126347.1.23604 WP_000126347.1.23679 WP_000126347.1.23728 WP_000126347.1.2375 WP_000126347.1.23783 WP_000126347.1.23786 WP_000126347.1.23787 WP_000126347.1.23801 WP_000126347.1.24028 WP_000126347.1.24061 WP_000126347.1.24083 WP_000126347.1.24117 WP_000126347.1.24125 WP_000126347.1.24138 WP_000126347.1.24153 WP_000126347.1.24291 WP_000126347.1.24322 WP_000126347.1.24355 WP_000126347.1.24375 WP_000126347.1.24394 WP_000126347.1.24400 WP_000126347.1.24420 WP_000126347.1.24619 WP_000126347.1.24643 WP_000126347.1.24688 WP_000126347.1.24716 WP_000126347.1.2481 WP_000126347.1.24832 WP_000126347.1.24964 WP_000126347.1.25017 WP_000126347.1.25032 WP_000126347.1.25041 WP_000126347.1.25053 WP_000126347.1.25140 WP_000126347.1.25185 WP_000126347.1.25196 WP_000126347.1.25210 WP_000126347.1.25219 WP_000126347.1.25304 WP_000126347.1.25374 WP_000126347.1.25475 WP_000126347.1.25490 WP_000126347.1.25508 WP_000126347.1.25512 WP_000126347.1.25603 WP_000126347.1.2562 WP_000126347.1.25666 WP_000126347.1.25807 WP_000126347.1.25821 WP_000126347.1.25833 WP_000126347.1.25835 WP_000126347.1.25846 WP_000126347.1.25882 WP_000126347.1.25911 WP_000126347.1.25962 WP_000126347.1.25963 WP_000126347.1.26001 WP_000126347.1.26027 WP_000126347.1.26107 WP_000126347.1.26122 WP_000126347.1.2615 WP_000126347.1.26199 WP_000126347.1.26217 WP_000126347.1.26230 WP_000126347.1.26232 WP_000126347.1.26272 WP_000126347.1.26286 WP_000126347.1.26288 WP_000126347.1.26394 WP_000126347.1.26491 WP_000126347.1.2654 WP_000126347.1.26554 WP_000126347.1.26636 WP_000126347.1.26689 WP_000126347.1.26750 WP_000126347.1.2679 WP_000126347.1.26908 WP_000126347.1.2692 WP_000126347.1.26928 WP_000126347.1.270 WP_000126347.1.27008 WP_000126347.1.27027 WP_000126347.1.27070 WP_000126347.1.27077 WP_000126347.1.27086 WP_000126347.1.27087 WP_000126347.1.27111 WP_000126347.1.27115 WP_000126347.1.2713 WP_000126347.1.2717 WP_000126347.1.27228 WP_000126347.1.27282 WP_000126347.1.27285 WP_000126347.1.27309 WP_000126347.1.27329 WP_000126347.1.27361 WP_000126347.1.27565 WP_000126347.1.27595 WP_000126347.1.27598 WP_000126347.1.27706 WP_000126347.1.27775 WP_000126347.1.27785 WP_000126347.1.27900 WP_000126347.1.27928 WP_000126347.1.27945 WP_000126347.1.28004 WP_000126347.1.2809 WP_000126347.1.28155 WP_000126347.1.28198 WP_000126347.1.2822 WP_000126347.1.28229 WP_000126347.1.28384 WP_000126347.1.28386 WP_000126347.1.28395 WP_000126347.1.284 WP_000126347.1.2845 WP_000126347.1.28479 WP_000126347.1.28514 WP_000126347.1.28627 WP_000126347.1.28692 WP_000126347.1.2873 WP_000126347.1.28917 WP_000126347.1.28962 WP_000126347.1.29023 WP_000126347.1.29042 WP_000126347.1.2905 WP_000126347.1.2907 WP_000126347.1.29081 WP_000126347.1.29089 WP_000126347.1.29153 WP_000126347.1.29203 WP_000126347.1.29237 WP_000126347.1.29248 WP_000126347.1.29288 WP_000126347.1.29389 WP_000126347.1.29439 WP_000126347.1.2946 WP_000126347.1.29462 WP_000126347.1.29563 WP_000126347.1.29727 WP_000126347.1.29743 WP_000126347.1.29782 WP_000126347.1.29833 WP_000126347.1.29851 WP_000126347.1.29865 WP_000126347.1.29886 WP_000126347.1.29919 WP_000126347.1.2994 WP_000126347.1.29964 WP_000126347.1.29983 WP_000126347.1.30009 WP_000126347.1.30013 WP_000126347.1.3002 WP_000126347.1.30034 WP_000126347.1.30049 WP_000126347.1.30058 WP_000126347.1.30172 WP_000126347.1.30185 WP_000126347.1.30354 WP_000126347.1.30357 WP_000126347.1.30362 WP_000126347.1.3042 WP_000126347.1.30421 WP_000126347.1.30440 WP_000126347.1.30448 WP_000126347.1.30489 WP_000126347.1.30517 WP_000126347.1.30542 WP_000126347.1.30544 WP_000126347.1.30555 WP_000126347.1.30556 WP_000126347.1.30572 WP_000126347.1.30585 WP_000126347.1.30618 WP_000126347.1.30664 WP_000126347.1.30688 WP_000126347.1.30806 WP_000126347.1.30967 WP_000126347.1.31046 WP_000126347.1.31066 WP_000126347.1.31069 WP_000126347.1.31078 WP_000126347.1.31139 WP_000126347.1.31145 WP_000126347.1.31182 WP_000126347.1.31205 WP_000126347.1.3121 WP_000126347.1.31223 WP_000126347.1.31303 WP_000126347.1.31352 WP_000126347.1.31389 WP_000126347.1.31413 WP_000126347.1.31446 WP_000126347.1.31533 WP_000126347.1.31546 WP_000126347.1.31799 WP_000126347.1.31836 WP_000126347.1.31951 WP_000126347.1.32041 WP_000126347.1.32042 WP_000126347.1.3207 WP_000126347.1.32189 WP_000126347.1.32202 WP_000126347.1.32263 WP_000126347.1.32293 WP_000126347.1.32299 WP_000126347.1.32422 WP_000126347.1.32425 WP_000126347.1.32458 WP_000126347.1.32460 WP_000126347.1.32529 WP_000126347.1.32563 WP_000126347.1.32578 WP_000126347.1.32617 WP_000126347.1.3270 WP_000126347.1.32725 WP_000126347.1.32838 WP_000126347.1.32848 WP_000126347.1.32868 WP_000126347.1.329 WP_000126347.1.3290 WP_000126347.1.32940 WP_000126347.1.32941 WP_000126347.1.3296 WP_000126347.1.32966 WP_000126347.1.32985 WP_000126347.1.33037 WP_000126347.1.3305 WP_000126347.1.33051 WP_000126347.1.33065 WP_000126347.1.33122 WP_000126347.1.3315 WP_000126347.1.33208 WP_000126347.1.33214 WP_000126347.1.33247 WP_000126347.1.33280 WP_000126347.1.33283 WP_000126347.1.33313 WP_000126347.1.33339 WP_000126347.1.33382 WP_000126347.1.33420 WP_000126347.1.33490 WP_000126347.1.33501 WP_000126347.1.33504 WP_000126347.1.33529 WP_000126347.1.33689 WP_000126347.1.3370 WP_000126347.1.33730 WP_000126347.1.33741 WP_000126347.1.33840 WP_000126347.1.3392 WP_000126347.1.33926 WP_000126347.1.33957 WP_000126347.1.33969 WP_000126347.1.34001 WP_000126347.1.34059 WP_000126347.1.34118 WP_000126347.1.34211 WP_000126347.1.34214 WP_000126347.1.34234 WP_000126347.1.34284 WP_000126347.1.34376 WP_000126347.1.34382 WP_000126347.1.34424 WP_000126347.1.34484 WP_000126347.1.34517 WP_000126347.1.34530 WP_000126347.1.34665 WP_000126347.1.34694 WP_000126347.1.34751 WP_000126347.1.34808 WP_000126347.1.34824 WP_000126347.1.34834 WP_000126347.1.34932 WP_000126347.1.34962 WP_000126347.1.35001 WP_000126347.1.35040 WP_000126347.1.35074 WP_000126347.1.35175 WP_000126347.1.35240 WP_000126347.1.35274 WP_000126347.1.35331 WP_000126347.1.35507 WP_000126347.1.35532 WP_000126347.1.35560 WP_000126347.1.3557 WP_000126347.1.35628 WP_000126347.1.3570 WP_000126347.1.35712 WP_000126347.1.35713 WP_000126347.1.35736 WP_000126347.1.35791 WP_000126347.1.35795 WP_000126347.1.35870 WP_000126347.1.35916 WP_000126347.1.35938 WP_000126347.1.35966 WP_000126347.1.36000 WP_000126347.1.36034 WP_000126347.1.36036 WP_000126347.1.36057 WP_000126347.1.36069 WP_000126347.1.36291 WP_000126347.1.36298 WP_000126347.1.36308 WP_000126347.1.36323 WP_000126347.1.36343 WP_000126347.1.36460 WP_000126347.1.3649 WP_000126347.1.36495 WP_000126347.1.36526 WP_000126347.1.36567 WP_000126347.1.36579 WP_000126347.1.36586 WP_000126347.1.36617 WP_000126347.1.36618 WP_000126347.1.36643 WP_000126347.1.36663 WP_000126347.1.36701 WP_000126347.1.36725 WP_000126347.1.36779 WP_000126347.1.36798 WP_000126347.1.36802 WP_000126347.1.36821 WP_000126347.1.36853 WP_000126347.1.36875 WP_000126347.1.36950 WP_000126347.1.37014 WP_000126347.1.37133 WP_000126347.1.37176 WP_000126347.1.37199 WP_000126347.1.37200 WP_000126347.1.37258 WP_000126347.1.37303 WP_000126347.1.37513 WP_000126347.1.37584 WP_000126347.1.37590 WP_000126347.1.37593 WP_000126347.1.37600 WP_000126347.1.37613 WP_000126347.1.37659 WP_000126347.1.37662 WP_000126347.1.37675 WP_000126347.1.37691 WP_000126347.1.37761 WP_000126347.1.37775 WP_000126347.1.37777 WP_000126347.1.378 WP_000126347.1.379 WP_000126347.1.37911 WP_000126347.1.37941 WP_000126347.1.37985 WP_000126347.1.38061 WP_000126347.1.38064 WP_000126347.1.38108 WP_000126347.1.3816 WP_000126347.1.38207 WP_000126347.1.38261 WP_000126347.1.38266 WP_000126347.1.38310 WP_000126347.1.3834 WP_000126347.1.38351 WP_000126347.1.3838 WP_000126347.1.38381 WP_000126347.1.38440 WP_000126347.1.38452 WP_000126347.1.38486 WP_000126347.1.38515 WP_000126347.1.38595 WP_000126347.1.3860 WP_000126347.1.38620 WP_000126347.1.38642 WP_000126347.1.38734 WP_000126347.1.38877 WP_000126347.1.38983 WP_000126347.1.38996 WP_000126347.1.39056 WP_000126347.1.3907 WP_000126347.1.39105 WP_000126347.1.39112 WP_000126347.1.3914 WP_000126347.1.39147 WP_000126347.1.39161 WP_000126347.1.39210 WP_000126347.1.39235 WP_000126347.1.3931 WP_000126347.1.39435 WP_000126347.1.39502 WP_000126347.1.39530 WP_000126347.1.39619 WP_000126347.1.39620 WP_000126347.1.39624 WP_000126347.1.39659 WP_000126347.1.39667 WP_000126347.1.39775 WP_000126347.1.39879 WP_000126347.1.39890 WP_000126347.1.39941 WP_000126347.1.39945 WP_000126347.1.39947 WP_000126347.1.39953 WP_000126347.1.40031 WP_000126347.1.40095 WP_000126347.1.40097 WP_000126347.1.401 WP_000126347.1.40160 WP_000126347.1.40167 WP_000126347.1.40279 WP_000126347.1.40361 WP_000126347.1.4042 WP_000126347.1.40467 WP_000126347.1.40496 WP_000126347.1.40517 WP_000126347.1.40688 WP_000126347.1.40698 WP_000126347.1.40750 WP_000126347.1.40763 WP_000126347.1.40854 WP_000126347.1.4089 WP_000126347.1.40924 WP_000126347.1.40932 WP_000126347.1.40946 WP_000126347.1.41004 WP_000126347.1.4106 WP_000126347.1.41070 WP_000126347.1.41074 WP_000126347.1.41075 WP_000126347.1.41097 WP_000126347.1.41132 WP_000126347.1.41176 WP_000126347.1.41251 WP_000126347.1.41258 WP_000126347.1.41305 WP_000126347.1.41321 WP_000126347.1.41333 WP_000126347.1.41335 WP_000126347.1.4136 WP_000126347.1.41415 WP_000126347.1.41459 WP_000126347.1.41498 WP_000126347.1.41519 WP_000126347.1.41631 WP_000126347.1.41658 WP_000126347.1.41659 WP_000126347.1.41716 WP_000126347.1.41746 WP_000126347.1.41824 WP_000126347.1.41825 WP_000126347.1.41836 WP_000126347.1.41894 WP_000126347.1.41919 WP_000126347.1.41929 WP_000126347.1.4194 WP_000126347.1.42069 WP_000126347.1.42081 WP_000126347.1.42090 WP_000126347.1.42098 WP_000126347.1.42111 WP_000126347.1.42187 WP_000126347.1.42200 WP_000126347.1.42219 WP_000126347.1.42257 WP_000126347.1.42261 WP_000126347.1.4229 WP_000126347.1.42349 WP_000126347.1.42364 WP_000126347.1.42371 WP_000126347.1.42372 WP_000126347.1.42379 WP_000126347.1.42391 WP_000126347.1.42399 WP_000126347.1.42539 WP_000126347.1.42603 WP_000126347.1.42650 WP_000126347.1.42701 WP_000126347.1.42805 WP_000126347.1.42815 WP_000126347.1.42859 WP_000126347.1.4298 WP_000126347.1.43008 WP_000126347.1.43016 WP_000126347.1.43019 WP_000126347.1.43065 WP_000126347.1.43068 WP_000126347.1.43069 WP_000126347.1.43128 WP_000126347.1.43141 WP_000126347.1.43157 WP_000126347.1.43161 WP_000126347.1.43190 WP_000126347.1.43198 WP_000126347.1.4326 WP_000126347.1.43290 WP_000126347.1.43292 WP_000126347.1.43307 WP_000126347.1.43513 WP_000126347.1.43633 WP_000126347.1.43637 WP_000126347.1.43651 WP_000126347.1.43722 WP_000126347.1.43801 WP_000126347.1.43812 WP_000126347.1.43878 WP_000126347.1.43888 WP_000126347.1.43919 WP_000126347.1.43974 WP_000126347.1.44049 WP_000126347.1.44101 WP_000126347.1.44144 WP_000126347.1.44160 WP_000126347.1.44180 WP_000126347.1.44196 WP_000126347.1.44248 WP_000126347.1.44262 WP_000126347.1.44268 WP_000126347.1.4427 WP_000126347.1.44296 WP_000126347.1.44343 WP_000126347.1.44351 WP_000126347.1.44360 WP_000126347.1.44416 WP_000126347.1.44431 WP_000126347.1.44437 WP_000126347.1.44546 WP_000126347.1.44606 WP_000126347.1.4468 WP_000126347.1.44687 WP_000126347.1.44762 WP_000126347.1.44815 WP_000126347.1.44828 WP_000126347.1.44879 WP_000126347.1.44917 WP_000126347.1.4501 WP_000126347.1.4505 WP_000126347.1.45072 WP_000126347.1.45093 WP_000126347.1.45136 WP_000126347.1.45241 WP_000126347.1.45435 WP_000126347.1.45523 WP_000126347.1.45596 WP_000126347.1.45648 WP_000126347.1.45829 WP_000126347.1.45871 WP_000126347.1.46030 WP_000126347.1.46077 WP_000126347.1.46169 WP_000126347.1.46225 WP_000126347.1.46241 WP_000126347.1.46307 WP_000126347.1.46355 WP_000126347.1.464 WP_000126347.1.46454 WP_000126347.1.46461 WP_000126347.1.46504 WP_000126347.1.46505 WP_000126347.1.46551 WP_000126347.1.46559 WP_000126347.1.46701 WP_000126347.1.46781 WP_000126347.1.46816 WP_000126347.1.46842 WP_000126347.1.4690 WP_000126347.1.46920 WP_000126347.1.46945 WP_000126347.1.47023 WP_000126347.1.47036 WP_000126347.1.47037 WP_000126347.1.47042 WP_000126347.1.47059 WP_000126347.1.47061 WP_000126347.1.47085 WP_000126347.1.47110 WP_000126347.1.47123 WP_000126347.1.47215 WP_000126347.1.47243 WP_000126347.1.47245 WP_000126347.1.47523 WP_000126347.1.47531 WP_000126347.1.47532 WP_000126347.1.47605 WP_000126347.1.47630 WP_000126347.1.47660 WP_000126347.1.4774 WP_000126347.1.47756 WP_000126347.1.4781 WP_000126347.1.47886 WP_000126347.1.47898 WP_000126347.1.48019 WP_000126347.1.48100 WP_000126347.1.48114 WP_000126347.1.48134 WP_000126347.1.48139 WP_000126347.1.48190 WP_000126347.1.48292 WP_000126347.1.48324 WP_000126347.1.48426 WP_000126347.1.48430 WP_000126347.1.48436 WP_000126347.1.48510 WP_000126347.1.48586 WP_000126347.1.4859 WP_000126347.1.48591 WP_000126347.1.48610 WP_000126347.1.48631 WP_000126347.1.48663 WP_000126347.1.48690 WP_000126347.1.48734 WP_000126347.1.48756 WP_000126347.1.48768 WP_000126347.1.48778 WP_000126347.1.48841 WP_000126347.1.48849 WP_000126347.1.48955 WP_000126347.1.48963 WP_000126347.1.48973 WP_000126347.1.49004 WP_000126347.1.49106 WP_000126347.1.49117 WP_000126347.1.49121 WP_000126347.1.4914 WP_000126347.1.49140 WP_000126347.1.49153 WP_000126347.1.49166 WP_000126347.1.49355 WP_000126347.1.49429 WP_000126347.1.49430 WP_000126347.1.49434 WP_000126347.1.49450 WP_000126347.1.49494 WP_000126347.1.495 WP_000126347.1.49545 WP_000126347.1.49703 WP_000126347.1.49769 WP_000126347.1.49790 WP_000126347.1.49846 WP_000126347.1.4991 WP_000126347.1.49947 WP_000126347.1.49959 WP_000126347.1.49997 WP_000126347.1.50030 WP_000126347.1.50043 WP_000126347.1.50103 WP_000126347.1.50153 WP_000126347.1.50158 WP_000126347.1.50247 WP_000126347.1.50308 WP_000126347.1.50309 WP_000126347.1.50387 WP_000126347.1.50406 WP_000126347.1.50468 WP_000126347.1.5051 WP_000126347.1.50529 WP_000126347.1.50566 WP_000126347.1.50570 WP_000126347.1.50626 WP_000126347.1.50726 WP_000126347.1.50750 WP_000126347.1.50771 WP_000126347.1.50875 WP_000126347.1.50885 WP_000126347.1.509 WP_000126347.1.50929 WP_000126347.1.50970 WP_000126347.1.51040 WP_000126347.1.51048 WP_000126347.1.51100 WP_000126347.1.51134 WP_000126347.1.51227 WP_000126347.1.5127 WP_000126347.1.51305 WP_000126347.1.51315 WP_000126347.1.5136 WP_000126347.1.51474 WP_000126347.1.51519 WP_000126347.1.51598 WP_000126347.1.51644 WP_000126347.1.51724 WP_000126347.1.51734 WP_000126347.1.51838 WP_000126347.1.5185 WP_000126347.1.51863 WP_000126347.1.51935 WP_000126347.1.52057 WP_000126347.1.52101 WP_000126347.1.52114 WP_000126347.1.52129 WP_000126347.1.52191 WP_000126347.1.52202 WP_000126347.1.52209 WP_000126347.1.52339 WP_000126347.1.52469 WP_000126347.1.52571 WP_000126347.1.526 WP_000126347.1.52647 WP_000126347.1.52742 WP_000126347.1.52773 WP_000126347.1.52795 WP_000126347.1.52807 WP_000126347.1.52887 WP_000126347.1.53092 WP_000126347.1.53141 WP_000126347.1.53151 WP_000126347.1.53154 WP_000126347.1.53159 WP_000126347.1.53210 WP_000126347.1.53233 WP_000126347.1.53307 WP_000126347.1.53321 WP_000126347.1.53368 WP_000126347.1.53375 WP_000126347.1.53450 WP_000126347.1.5349 WP_000126347.1.53540 WP_000126347.1.53555 WP_000126347.1.53559 WP_000126347.1.5356 WP_000126347.1.53571 WP_000126347.1.5358 WP_000126347.1.53692 WP_000126347.1.53723 WP_000126347.1.5374 WP_000126347.1.53750 WP_000126347.1.53800 WP_000126347.1.53815 WP_000126347.1.53839 WP_000126347.1.53892 WP_000126347.1.53898 WP_000126347.1.53902 WP_000126347.1.53958 WP_000126347.1.53981 WP_000126347.1.53984 WP_000126347.1.54132 WP_000126347.1.54170 WP_000126347.1.54175 WP_000126347.1.54203 WP_000126347.1.54259 WP_000126347.1.5430 WP_000126347.1.54371 WP_000126347.1.54431 WP_000126347.1.54442 WP_000126347.1.54482 WP_000126347.1.54589 WP_000126347.1.5462 WP_000126347.1.54667 WP_000126347.1.54678 WP_000126347.1.54681 WP_000126347.1.54748 WP_000126347.1.5481 WP_000126347.1.54865 WP_000126347.1.54935 WP_000126347.1.54979 WP_000126347.1.55010 WP_000126347.1.55034 WP_000126347.1.55163 WP_000126347.1.55165 WP_000126347.1.55200 WP_000126347.1.55215 WP_000126347.1.55290 WP_000126347.1.55310 WP_000126347.1.55317 WP_000126347.1.55379 WP_000126347.1.5539 WP_000126347.1.55468 WP_000126347.1.55506 WP_000126347.1.55604 WP_000126347.1.55639 WP_000126347.1.55699 WP_000126347.1.55725 WP_000126347.1.55780 WP_000126347.1.55967 WP_000126347.1.56070 WP_000126347.1.56144 WP_000126347.1.56172 WP_000126347.1.5621 WP_000126347.1.56226 WP_000126347.1.56311 WP_000126347.1.56374 WP_000126347.1.56419 WP_000126347.1.56423 WP_000126347.1.56514 WP_000126347.1.56535 WP_000126347.1.56585 WP_000126347.1.56640 WP_000126347.1.56724 WP_000126347.1.56791 WP_000126347.1.56825 WP_000126347.1.56887 WP_000126347.1.56889 WP_000126347.1.56942 WP_000126347.1.56981 WP_000126347.1.57101 WP_000126347.1.57137 WP_000126347.1.57147 WP_000126347.1.57179 WP_000126347.1.57186 WP_000126347.1.57244 WP_000126347.1.57342 WP_000126347.1.5761 WP_000126347.1.57684 WP_000126347.1.57699 WP_000126347.1.57785 WP_000126347.1.57800 WP_000126347.1.57873 WP_000126347.1.57965 WP_000126347.1.57972 WP_000126347.1.58008 WP_000126347.1.58044 WP_000126347.1.58081 WP_000126347.1.5809 WP_000126347.1.58132 WP_000126347.1.58173 WP_000126347.1.58191 WP_000126347.1.58194 WP_000126347.1.58252 WP_000126347.1.58261 WP_000126347.1.58274 WP_000126347.1.58282 WP_000126347.1.58324 WP_000126347.1.58326 WP_000126347.1.5836 WP_000126347.1.58467 WP_000126347.1.58485 WP_000126347.1.58537 WP_000126347.1.58568 WP_000126347.1.58583 WP_000126347.1.58652 WP_000126347.1.58663 WP_000126347.1.58724 WP_000126347.1.5875 WP_000126347.1.58796 WP_000126347.1.58807 WP_000126347.1.58847 WP_000126347.1.58883 WP_000126347.1.58898 WP_000126347.1.58949 WP_000126347.1.58963 WP_000126347.1.58970 WP_000126347.1.58974 WP_000126347.1.59020 WP_000126347.1.59043 WP_000126347.1.59056 WP_000126347.1.59061 WP_000126347.1.59064 WP_000126347.1.59068 WP_000126347.1.59276 WP_000126347.1.59282 WP_000126347.1.59299 WP_000126347.1.59313 WP_000126347.1.5949 WP_000126347.1.59501 WP_000126347.1.59510 WP_000126347.1.5969 WP_000126347.1.59751 WP_000126347.1.59827 WP_000126347.1.59829 WP_000126347.1.59847 WP_000126347.1.59863 WP_000126347.1.59969 WP_000126347.1.59994 WP_000126347.1.60045 WP_000126347.1.60076 WP_000126347.1.60114 WP_000126347.1.60154 WP_000126347.1.60168 WP_000126347.1.60192 WP_000126347.1.60199 WP_000126347.1.60212 WP_000126347.1.60253 WP_000126347.1.60322 WP_000126347.1.60324 WP_000126347.1.60356 WP_000126347.1.6038 WP_000126347.1.60380 WP_000126347.1.6041 WP_000126347.1.60424 WP_000126347.1.60481 WP_000126347.1.605 WP_000126347.1.6058 WP_000126347.1.60584 WP_000126347.1.6060 WP_000126347.1.60676 WP_000126347.1.60708 WP_000126347.1.60783 WP_000126347.1.60792 WP_000126347.1.60807 WP_000126347.1.60809 WP_000126347.1.60882 WP_000126347.1.60889 WP_000126347.1.60950 WP_000126347.1.6104 WP_000126347.1.61044 WP_000126347.1.61076 WP_000126347.1.61123 WP_000126347.1.61147 WP_000126347.1.61168 WP_000126347.1.61210 WP_000126347.1.61309 WP_000126347.1.61357 WP_000126347.1.6143 WP_000126347.1.61511 WP_000126347.1.61539 WP_000126347.1.61542 WP_000126347.1.61553 WP_000126347.1.61649 WP_000126347.1.61652 WP_000126347.1.61694 WP_000126347.1.61697 WP_000126347.1.61809 WP_000126347.1.61877 WP_000126347.1.61920 WP_000126347.1.62063 WP_000126347.1.62124 WP_000126347.1.62195 WP_000126347.1.62199 WP_000126347.1.62223 WP_000126347.1.62302 WP_000126347.1.62314 WP_000126347.1.62323 WP_000126347.1.62333 WP_000126347.1.62338 WP_000126347.1.62380 WP_000126347.1.62411 WP_000126347.1.62436 WP_000126347.1.62475 WP_000126347.1.62536 WP_000126347.1.62640 WP_000126347.1.62686 WP_000126347.1.62751 WP_000126347.1.62825 WP_000126347.1.62913 WP_000126347.1.62932 WP_000126347.1.62960 WP_000126347.1.63016 WP_000126347.1.63025 WP_000126347.1.63069 WP_000126347.1.63087 WP_000126347.1.63297 WP_000126347.1.63448 WP_000126347.1.63514 WP_000126347.1.63583 WP_000126347.1.63592 WP_000126347.1.63663 WP_000126347.1.63736 WP_000126347.1.63816 WP_000126347.1.63876 WP_000126347.1.6389 WP_000126347.1.63901 WP_000126347.1.63955 WP_000126347.1.63963 WP_000126347.1.64032 WP_000126347.1.64087 WP_000126347.1.6415 WP_000126347.1.64293 WP_000126347.1.64332 WP_000126347.1.64376 WP_000126347.1.644 WP_000126347.1.64471 WP_000126347.1.64501 WP_000126347.1.64538 WP_000126347.1.64632 WP_000126347.1.64648 WP_000126347.1.64662 WP_000126347.1.64663 WP_000126347.1.64709 WP_000126347.1.64710 WP_000126347.1.64744 WP_000126347.1.64758 WP_000126347.1.64763 WP_000126347.1.64817 WP_000126347.1.64847 WP_000126347.1.6487 WP_000126347.1.64891 WP_000126347.1.64974 WP_000126347.1.65054 WP_000126347.1.65075 WP_000126347.1.6514 WP_000126347.1.65172 WP_000126347.1.65191 WP_000126347.1.65200 WP_000126347.1.65211 WP_000126347.1.65218 WP_000126347.1.65226 WP_000126347.1.65249 WP_000126347.1.65266 WP_000126347.1.65395 WP_000126347.1.65459 WP_000126347.1.65463 WP_000126347.1.65475 WP_000126347.1.65487 WP_000126347.1.6549 WP_000126347.1.65499 WP_000126347.1.6554 WP_000126347.1.65650 WP_000126347.1.65697 WP_000126347.1.65699 WP_000126347.1.65737 WP_000126347.1.65755 WP_000126347.1.65812 WP_000126347.1.65818 WP_000126347.1.65846 WP_000126347.1.65863 WP_000126347.1.65945 WP_000126347.1.65985 WP_000126347.1.66021 WP_000126347.1.66031 WP_000126347.1.66052 WP_000126347.1.66064 WP_000126347.1.66109 WP_000126347.1.66145 WP_000126347.1.66183 WP_000126347.1.6620 WP_000126347.1.66216 WP_000126347.1.66234 WP_000126347.1.66273 WP_000126347.1.66324 WP_000126347.1.6634 WP_000126347.1.66361 WP_000126347.1.66480 WP_000126347.1.66506 WP_000126347.1.66665 WP_000126347.1.66681 WP_000126347.1.66684 WP_000126347.1.66755 WP_000126347.1.66759 WP_000126347.1.66801 WP_000126347.1.66860 WP_000126347.1.66953 WP_000126347.1.66955 WP_000126347.1.66981 WP_000126347.1.67024 WP_000126347.1.67042 WP_000126347.1.67101 WP_000126347.1.67143 WP_000126347.1.67201 WP_000126347.1.67211 WP_000126347.1.67228 WP_000126347.1.67237 WP_000126347.1.67336 WP_000126347.1.67339 WP_000126347.1.67387 WP_000126347.1.67394 WP_000126347.1.67397 WP_000126347.1.67430 WP_000126347.1.67442 WP_000126347.1.67539 WP_000126347.1.67556 WP_000126347.1.67576 WP_000126347.1.67604 WP_000126347.1.67619 WP_000126347.1.67625 WP_000126347.1.67627 WP_000126347.1.67641 WP_000126347.1.67657 WP_000126347.1.67673 WP_000126347.1.67700 WP_000126347.1.67718 WP_000126347.1.67729 WP_000126347.1.67774 WP_000126347.1.67820 WP_000126347.1.67825 WP_000126347.1.67910 WP_000126347.1.67954 WP_000126347.1.68 WP_000126347.1.68043 WP_000126347.1.68105 WP_000126347.1.68113 WP_000126347.1.68131 WP_000126347.1.68182 WP_000126347.1.6819 WP_000126347.1.68285 WP_000126347.1.68359 WP_000126347.1.68420 WP_000126347.1.68514 WP_000126347.1.68564 WP_000126347.1.68688 WP_000126347.1.68742 WP_000126347.1.68770 WP_000126347.1.68809 WP_000126347.1.68914 WP_000126347.1.69053 WP_000126347.1.69170 WP_000126347.1.69210 WP_000126347.1.69270 WP_000126347.1.69282 WP_000126347.1.69376 WP_000126347.1.69396 WP_000126347.1.69433 WP_000126347.1.69466 WP_000126347.1.69611 WP_000126347.1.69642 WP_000126347.1.69656 WP_000126347.1.69657 WP_000126347.1.69690 WP_000126347.1.69839 WP_000126347.1.69923 WP_000126347.1.69948 WP_000126347.1.69953 WP_000126347.1.70010 WP_000126347.1.70049 WP_000126347.1.70058 WP_000126347.1.70061 WP_000126347.1.70205 WP_000126347.1.70240 WP_000126347.1.70249 WP_000126347.1.70261 WP_000126347.1.70314 WP_000126347.1.7033 WP_000126347.1.70427 WP_000126347.1.70433 WP_000126347.1.70545 WP_000126347.1.7060 WP_000126347.1.70623 WP_000126347.1.70662 WP_000126347.1.70671 WP_000126347.1.70679 WP_000126347.1.70708 WP_000126347.1.70717 WP_000126347.1.70731 WP_000126347.1.70772 WP_000126347.1.70845 WP_000126347.1.70846 WP_000126347.1.70981 WP_000126347.1.70995 WP_000126347.1.71039 WP_000126347.1.71057 WP_000126347.1.71081 WP_000126347.1.71117 WP_000126347.1.71186 WP_000126347.1.71455 WP_000126347.1.71456 WP_000126347.1.71487 WP_000126347.1.71523 WP_000126347.1.71542 WP_000126347.1.71566 WP_000126347.1.71640 WP_000126347.1.71651 WP_000126347.1.71653 WP_000126347.1.71656 WP_000126347.1.71716 WP_000126347.1.71848 WP_000126347.1.71872 WP_000126347.1.71950 WP_000126347.1.71954 WP_000126347.1.71985 WP_000126347.1.72003 WP_000126347.1.72073 WP_000126347.1.72121 WP_000126347.1.72254 WP_000126347.1.72269 WP_000126347.1.72350 WP_000126347.1.72383 WP_000126347.1.72461 WP_000126347.1.72527 WP_000126347.1.7255 WP_000126347.1.72631 WP_000126347.1.72638 WP_000126347.1.72667 WP_000126347.1.72674 WP_000126347.1.72724 WP_000126347.1.72789 WP_000126347.1.72797 WP_000126347.1.72828 WP_000126347.1.72896 WP_000126347.1.72946 WP_000126347.1.72969 WP_000126347.1.72987 WP_000126347.1.73052 WP_000126347.1.73102 WP_000126347.1.7311 WP_000126347.1.73114 WP_000126347.1.73177 WP_000126347.1.73180 WP_000126347.1.73258 WP_000126347.1.73285 WP_000126347.1.7332 WP_000126347.1.7333 WP_000126347.1.73352 WP_000126347.1.73389 WP_000126347.1.73425 WP_000126347.1.73488 WP_000126347.1.73504 WP_000126347.1.7353 WP_000126347.1.73544 WP_000126347.1.73598 WP_000126347.1.7361 WP_000126347.1.73648 WP_000126347.1.73768 WP_000126347.1.73849 WP_000126347.1.73948 WP_000126347.1.73958 WP_000126347.1.73999 WP_000126347.1.74024 WP_000126347.1.74030 WP_000126347.1.74038 WP_000126347.1.74043 WP_000126347.1.74058 WP_000126347.1.74070 WP_000126347.1.74077 WP_000126347.1.74135 WP_000126347.1.74214 WP_000126347.1.74241 WP_000126347.1.74285 WP_000126347.1.7430 WP_000126347.1.74317 WP_000126347.1.74415 WP_000126347.1.74616 WP_000126347.1.74621 WP_000126347.1.74647 WP_000126347.1.74677 WP_000126347.1.74699 WP_000126347.1.74741 WP_000126347.1.74831 WP_000126347.1.74894 WP_000126347.1.74929 WP_000126347.1.74939 WP_000126347.1.74973 WP_000126347.1.7507 WP_000126347.1.75089 WP_000126347.1.75116 WP_000126347.1.75237 WP_000126347.1.75273 WP_000126347.1.75296 WP_000126347.1.75371 WP_000126347.1.75413 WP_000126347.1.75433 WP_000126347.1.75532 WP_000126347.1.75565 WP_000126347.1.75593 WP_000126347.1.75610 WP_000126347.1.75633 WP_000126347.1.75718 WP_000126347.1.75745 WP_000126347.1.75844 WP_000126347.1.75886 WP_000126347.1.75898 WP_000126347.1.76081 WP_000126347.1.76115 WP_000126347.1.76116 WP_000126347.1.76122 WP_000126347.1.76256 WP_000126347.1.76339 WP_000126347.1.76366 WP_000126347.1.76417 WP_000126347.1.7646 WP_000126347.1.76510 WP_000126347.1.76558 WP_000126347.1.76572 WP_000126347.1.76641 WP_000126347.1.76651 WP_000126347.1.76653 WP_000126347.1.76788 WP_000126347.1.76854 WP_000126347.1.76916 WP_000126347.1.76932 WP_000126347.1.76973 WP_000126347.1.76988 WP_000126347.1.77016 WP_000126347.1.77087 WP_000126347.1.77090 WP_000126347.1.77111 WP_000126347.1.77299 WP_000126347.1.77384 WP_000126347.1.77501 WP_000126347.1.77512 WP_000126347.1.77513 WP_000126347.1.77563 WP_000126347.1.77702 WP_000126347.1.77713 WP_000126347.1.7772 WP_000126347.1.77825 WP_000126347.1.77837 WP_000126347.1.7784 WP_000126347.1.77900 WP_000126347.1.77923 WP_000126347.1.77975 WP_000126347.1.78035 WP_000126347.1.78048 WP_000126347.1.78107 WP_000126347.1.78166 WP_000126347.1.78192 WP_000126347.1.78195 WP_000126347.1.78291 WP_000126347.1.78309 WP_000126347.1.78320 WP_000126347.1.78352 WP_000126347.1.78382 WP_000126347.1.78388 WP_000126347.1.78410 WP_000126347.1.7862 WP_000126347.1.78626 WP_000126347.1.78661 WP_000126347.1.78674 WP_000126347.1.78676 WP_000126347.1.78761 WP_000126347.1.789 WP_000126347.1.78959 WP_000126347.1.78993 WP_000126347.1.79012 WP_000126347.1.79069 WP_000126347.1.79074 WP_000126347.1.79098 WP_000126347.1.79155 WP_000126347.1.79164 WP_000126347.1.79204 WP_000126347.1.79280 WP_000126347.1.79397 WP_000126347.1.79456 WP_000126347.1.79531 WP_000126347.1.79532 WP_000126347.1.79547 WP_000126347.1.79654 WP_000126347.1.7970 WP_000126347.1.79722 WP_000126347.1.79772 WP_000126347.1.79880 WP_000126347.1.79916 WP_000126347.1.79977 WP_000126347.1.80045 WP_000126347.1.80065 WP_000126347.1.80103 WP_000126347.1.80273 WP_000126347.1.80282 WP_000126347.1.80354 WP_000126347.1.80368 WP_000126347.1.80386 WP_000126347.1.80400 WP_000126347.1.80462 WP_000126347.1.8049 WP_000126347.1.80492 WP_000126347.1.80569 WP_000126347.1.80664 WP_000126347.1.80696 WP_000126347.1.80984 WP_000126347.1.81041 WP_000126347.1.81084 WP_000126347.1.81131 WP_000126347.1.81187 WP_000126347.1.81262 WP_000126347.1.81268 WP_000126347.1.81269 WP_000126347.1.81271 WP_000126347.1.8131 WP_000126347.1.81333 WP_000126347.1.81342 WP_000126347.1.81364 WP_000126347.1.81494 WP_000126347.1.81557 WP_000126347.1.81568 WP_000126347.1.81676 WP_000126347.1.81681 WP_000126347.1.8170 WP_000126347.1.81763 WP_000126347.1.81855 WP_000126347.1.81921 WP_000126347.1.81931 WP_000126347.1.81936 WP_000126347.1.81949 WP_000126347.1.82070 WP_000126347.1.82076 WP_000126347.1.82131 WP_000126347.1.82156 WP_000126347.1.8218 WP_000126347.1.82180 WP_000126347.1.82201 WP_000126347.1.82214 WP_000126347.1.82225 WP_000126347.1.8240 WP_000126347.1.82408 WP_000126347.1.82416 WP_000126347.1.8242 WP_000126347.1.82456 WP_000126347.1.82465 WP_000126347.1.82473 WP_000126347.1.82553 WP_000126347.1.82646 WP_000126347.1.82670 WP_000126347.1.82692 WP_000126347.1.82731 WP_000126347.1.82812 WP_000126347.1.82850 WP_000126347.1.82872 WP_000126347.1.8294 WP_000126347.1.82959 WP_000126347.1.83007 WP_000126347.1.8304 WP_000126347.1.83180 WP_000126347.1.83229 WP_000126347.1.83235 WP_000126347.1.83280 WP_000126347.1.83290 WP_000126347.1.83333 WP_000126347.1.83657 WP_000126347.1.83677 WP_000126347.1.8375 WP_000126347.1.83806 WP_000126347.1.83923 WP_000126347.1.83994 WP_000126347.1.84 WP_000126347.1.8406 WP_000126347.1.84076 WP_000126347.1.84110 WP_000126347.1.84127 WP_000126347.1.84150 WP_000126347.1.84230 WP_000126347.1.84252 WP_000126347.1.8431 WP_000126347.1.84345 WP_000126347.1.84369 WP_000126347.1.84401 WP_000126347.1.84435 WP_000126347.1.84567 WP_000126347.1.84631 WP_000126347.1.84727 WP_000126347.1.84744 WP_000126347.1.84773 WP_000126347.1.84814 WP_000126347.1.84872 WP_000126347.1.84879 WP_000126347.1.84945 WP_000126347.1.84967 WP_000126347.1.85004 WP_000126347.1.8502 WP_000126347.1.85039 WP_000126347.1.85153 WP_000126347.1.85273 WP_000126347.1.85338 WP_000126347.1.85339 WP_000126347.1.85511 WP_000126347.1.85512 WP_000126347.1.8557 WP_000126347.1.85606 WP_000126347.1.85635 WP_000126347.1.85646 WP_000126347.1.85665 WP_000126347.1.85669 WP_000126347.1.85688 WP_000126347.1.85703 WP_000126347.1.85728 WP_000126347.1.85746 WP_000126347.1.85811 WP_000126347.1.859 WP_000126347.1.85917 WP_000126347.1.8594 WP_000126347.1.85977 WP_000126347.1.860 WP_000126347.1.8605 WP_000126347.1.86084 WP_000126347.1.8610 WP_000126347.1.8614 WP_000126347.1.86156 WP_000126347.1.86323 WP_000126347.1.86342 WP_000126347.1.8640 WP_000126347.1.8642 WP_000126347.1.86426 WP_000126347.1.86466 WP_000126347.1.86489 WP_000126347.1.86530 WP_000126347.1.86663 WP_000126347.1.86770 WP_000126347.1.86794 WP_000126347.1.86800 WP_000126347.1.86811 WP_000126347.1.86815 WP_000126347.1.86945 WP_000126347.1.86989 WP_000126347.1.87023 WP_000126347.1.87034 WP_000126347.1.87041 WP_000126347.1.87136 WP_000126347.1.87155 WP_000126347.1.87220 WP_000126347.1.87276 WP_000126347.1.87293 WP_000126347.1.87376 WP_000126347.1.87420 WP_000126347.1.87528 WP_000126347.1.87560 WP_000126347.1.8760 WP_000126347.1.87600 WP_000126347.1.87609 WP_000126347.1.87612 WP_000126347.1.87615 WP_000126347.1.87651 WP_000126347.1.87653 WP_000126347.1.87659 WP_000126347.1.87698 WP_000126347.1.87706 WP_000126347.1.87739 WP_000126347.1.87741 WP_000126347.1.87742 WP_000126347.1.87852 WP_000126347.1.87891 WP_000126347.1.87949 WP_000126347.1.88025 WP_000126347.1.88026 WP_000126347.1.8805 WP_000126347.1.8806 WP_000126347.1.881 WP_000126347.1.88145 WP_000126347.1.88199 WP_000126347.1.88299 WP_000126347.1.88313 WP_000126347.1.88359 WP_000126347.1.88407 WP_000126347.1.88414 WP_000126347.1.88444 WP_000126347.1.88446 WP_000126347.1.88458 WP_000126347.1.88501 WP_000126347.1.88538 WP_000126347.1.88547 WP_000126347.1.886 WP_000126347.1.88647 WP_000126347.1.88648 WP_000126347.1.88692 WP_000126347.1.88707 WP_000126347.1.88727 WP_000126347.1.88772 WP_000126347.1.88817 WP_000126347.1.88850 WP_000126347.1.8889 WP_000126347.1.88892 WP_000126347.1.88894 WP_000126347.1.89182 WP_000126347.1.89298 WP_000126347.1.89308 WP_000126347.1.89314 WP_000126347.1.89328 WP_000126347.1.89332 WP_000126347.1.89343 WP_000126347.1.89395 WP_000126347.1.8940 WP_000126347.1.89449 WP_000126347.1.8947 WP_000126347.1.89503 WP_000126347.1.89591 WP_000126347.1.89612 WP_000126347.1.89668 WP_000126347.1.89706 WP_000126347.1.89713 WP_000126347.1.89733 WP_000126347.1.89764 WP_000126347.1.89796 WP_000126347.1.89804 WP_000126347.1.89845 WP_000126347.1.89888 WP_000126347.1.89911 WP_000126347.1.8995 WP_000126347.1.89952 WP_000126347.1.90007 WP_000126347.1.9011 WP_000126347.1.90196 WP_000126347.1.90240 WP_000126347.1.90274 WP_000126347.1.90280 WP_000126347.1.90330 WP_000126347.1.90338 WP_000126347.1.90365 WP_000126347.1.90428 WP_000126347.1.90489 WP_000126347.1.90513 WP_000126347.1.90582 WP_000126347.1.90713 WP_000126347.1.90794 WP_000126347.1.90796 WP_000126347.1.90811 WP_000126347.1.9091 WP_000126347.1.91067 WP_000126347.1.91164 WP_000126347.1.91205 WP_000126347.1.91239 WP_000126347.1.91282 WP_000126347.1.91291 WP_000126347.1.91312 WP_000126347.1.91313 WP_000126347.1.91331 WP_000126347.1.9135 WP_000126347.1.91506 WP_000126347.1.91557 WP_000126347.1.91597 WP_000126347.1.9166 WP_000126347.1.91715 WP_000126347.1.9187 WP_000126347.1.91870 WP_000126347.1.91984 WP_000126347.1.92018 WP_000126347.1.92087 WP_000126347.1.92098 WP_000126347.1.92156 WP_000126347.1.92172 WP_000126347.1.92240 WP_000126347.1.92243 WP_000126347.1.92327 WP_000126347.1.92470 WP_000126347.1.92477 WP_000126347.1.92545 WP_000126347.1.92570 WP_000126347.1.92588 WP_000126347.1.926 WP_000126347.1.92633 WP_000126347.1.92646 WP_000126347.1.92649 WP_000126347.1.92676 WP_000126347.1.92705 WP_000126347.1.9271 WP_000126347.1.92734 WP_000126347.1.92786 WP_000126347.1.92810 WP_000126347.1.92823 WP_000126347.1.92842 WP_000126347.1.92936 WP_000126347.1.92987 WP_000126347.1.93007 WP_000126347.1.93022 WP_000126347.1.93103 WP_000126347.1.93105 WP_000126347.1.93111 WP_000126347.1.93118 WP_000126347.1.93121 WP_000126347.1.93168 WP_000126347.1.93184 WP_000126347.1.93221 WP_000126347.1.93223 WP_000126347.1.93239 WP_000126347.1.93302 WP_000126347.1.9336 WP_000126347.1.93387 WP_000126347.1.93469 WP_000126347.1.93511 WP_000126347.1.93512 WP_000126347.1.93635 WP_000126347.1.93657 WP_000126347.1.9374 WP_000126347.1.9375 WP_000126347.1.93754 WP_000126347.1.93780 WP_000126347.1.93828 WP_000126347.1.93842 WP_000126347.1.93843 WP_000126347.1.93875 WP_000126347.1.93909 WP_000126347.1.93919 WP_000126347.1.93938 WP_000126347.1.93984 WP_000126347.1.9399 WP_000126347.1.94017 WP_000126347.1.94071 WP_000126347.1.94079 WP_000126347.1.94097 WP_000126347.1.94107 WP_000126347.1.94142 WP_000126347.1.94215 WP_000126347.1.94303 WP_000126347.1.94365 WP_000126347.1.94390 WP_000126347.1.94415 WP_000126347.1.94492 WP_000126347.1.94510 WP_000126347.1.94527 WP_000126347.1.94573 WP_000126347.1.94579 WP_000126347.1.94586 WP_000126347.1.94593 WP_000126347.1.94650 WP_000126347.1.94659 WP_000126347.1.94662 WP_000126347.1.94700 WP_000126347.1.94745 WP_000126347.1.94782 WP_000126347.1.94815 WP_000126347.1.94820 WP_000126347.1.94850 WP_000126347.1.94851 WP_000126347.1.94864 WP_000126347.1.94952 WP_000126347.1.95006 WP_000126347.1.95055 WP_000126347.1.95076 WP_000126347.1.95099 WP_000126347.1.95133 WP_000126347.1.95165 WP_000126347.1.95239 WP_000126347.1.95246 WP_000126347.1.9525 WP_000126347.1.95255 WP_000126347.1.95265 WP_000126347.1.95338 WP_000126347.1.95412 WP_000126347.1.95530 WP_000126347.1.95547 WP_000126347.1.95590 WP_000126347.1.95625 WP_000126347.1.95675 WP_000126347.1.95716 WP_000126347.1.95776 WP_000126347.1.95884 WP_000126347.1.95890 WP_000126347.1.95906 WP_000126347.1.96025 WP_000126347.1.96044 WP_000126347.1.96054 WP_000126347.1.96094 WP_000126347.1.96127 WP_000126347.1.96144 WP_000126347.1.96188 WP_000126347.1.96211 WP_000126347.1.96212 WP_000126347.1.9628 WP_000126347.1.96319 WP_000126347.1.9633 WP_000126347.1.96359 WP_000126347.1.96539 WP_000126347.1.96552 WP_000126347.1.96610 WP_000126347.1.96625 WP_000126347.1.96635 WP_000126347.1.9664 WP_000126347.1.96675 WP_000126347.1.9670 WP_000126347.1.96731 WP_000126347.1.96750 WP_000126347.1.96792 WP_000126347.1.96801 WP_000126347.1.96803 WP_000126347.1.96925 WP_000126347.1.96938 WP_000126347.1.96946 WP_000126347.1.96957 WP_000126347.1.96978 WP_000126347.1.97026 WP_000126347.1.97028 WP_000126347.1.97079 WP_000126347.1.97154 WP_000126347.1.97184 WP_000126347.1.97287 WP_000126347.1.97291 WP_000126347.1.97422 WP_000126347.1.97441 WP_000126347.1.97497 WP_000126347.1.97505 WP_000126347.1.97599 WP_000126347.1.97606 WP_000126347.1.97615 WP_000126347.1.97646 WP_000126347.1.97690 WP_000126347.1.97819 WP_000126347.1.97840 WP_000126347.1.97938 WP_000126347.1.97986 WP_000126347.1.98036 WP_000126347.1.98080 WP_000126347.1.98086 WP_000126347.1.98158 WP_000126347.1.98263 WP_000126347.1.98418 WP_000126347.1.98448 WP_000126347.1.98457 WP_000126347.1.9850 WP_000126347.1.98502 WP_000126347.1.98607 WP_000126347.1.98731 WP_000126347.1.98762 WP_000126347.1.9877 WP_000126347.1.98801 WP_000126347.1.98818 WP_000126347.1.99073 WP_000126347.1.99163 WP_000126347.1.99335 WP_000126347.1.99350 WP_000126347.1.99360 WP_000126347.1.99363 WP_000126347.1.99369 WP_000126347.1.99388 WP_000126347.1.99397 WP_000126347.1.99463 WP_000126347.1.99483 WP_000126347.1.99531 WP_000126347.1.99546 WP_000126347.1.99579 WP_000126347.1.99595 WP_000126347.1.99671 WP_000126347.1.99676 WP_000126347.1.99764 WP_000126347.1.99829 WP_000126347.1.99837 WP_000126347.1.99841 WP_000126347.1.9992 WP_000126347.1.99996 gi|56413006|ref|YP_150081.1| gi|488653318|ref|YP_007925121.1| gi|16761022|ref|NP_456639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]